Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MZS1

Protein Details
Accession A0A5M3MZS1    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
108-130PMESLRSSRRDMRRRWRPQRRRRBasic
NLS Segment(s)
PositionSequence
114-130SSRRDMRRRWRPQRRRR
Subcellular Location(s) mito 22, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
KEGG cput:CONPUDRAFT_162020  -  
Amino Acid Sequences MFRILLLTISRRCQIRVILRLRRPACSHRWREWKWQVYAPAPPVRLRAPVSCTIEIGGCYRYIEEYDAKDLRRTMEHLSQVHRLFPLSAAENIGVGADQRCRPRSWGPMESLRSSRRDMRRRWRPQRRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.46
4 0.51
5 0.57
6 0.61
7 0.7
8 0.68
9 0.66
10 0.62
11 0.6
12 0.6
13 0.61
14 0.63
15 0.63
16 0.72
17 0.71
18 0.76
19 0.8
20 0.78
21 0.71
22 0.69
23 0.64
24 0.56
25 0.56
26 0.51
27 0.45
28 0.39
29 0.35
30 0.33
31 0.29
32 0.3
33 0.28
34 0.25
35 0.25
36 0.3
37 0.34
38 0.31
39 0.3
40 0.26
41 0.24
42 0.22
43 0.19
44 0.13
45 0.08
46 0.07
47 0.07
48 0.07
49 0.07
50 0.08
51 0.09
52 0.09
53 0.13
54 0.15
55 0.15
56 0.17
57 0.17
58 0.16
59 0.16
60 0.18
61 0.17
62 0.21
63 0.25
64 0.26
65 0.29
66 0.34
67 0.33
68 0.32
69 0.28
70 0.23
71 0.18
72 0.17
73 0.16
74 0.12
75 0.12
76 0.12
77 0.12
78 0.11
79 0.11
80 0.1
81 0.07
82 0.06
83 0.06
84 0.09
85 0.13
86 0.18
87 0.21
88 0.22
89 0.27
90 0.32
91 0.4
92 0.45
93 0.47
94 0.47
95 0.54
96 0.58
97 0.58
98 0.58
99 0.53
100 0.48
101 0.47
102 0.51
103 0.52
104 0.57
105 0.62
106 0.67
107 0.74
108 0.83
109 0.9
110 0.92