Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3N156

Protein Details
Accession A0A5M3N156    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-60VFRFCTSKCHKNFKMKRNPRKVRWTKAFRKAAGHydrophilic
NLS Segment(s)
PositionSequence
41-59KMKRNPRKVRWTKAFRKAA
Subcellular Location(s) mito 12.5, mito_nucl 10.166, cyto_nucl 8.333, cyto 8, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
KEGG cput:CONPUDRAFT_47995  -  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIEKCYFCSTNVYPGHGSAFVRNDAKVFRFCTSKCHKNFKMKRNPRKVRWTKAFRKAAGKEMTIDSTIDFEKRRNVPVRYDRELVKTTLKAMKRIGEIKQRREHAFWKHRCVGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.33
4 0.28
5 0.27
6 0.22
7 0.22
8 0.22
9 0.23
10 0.22
11 0.21
12 0.22
13 0.24
14 0.23
15 0.24
16 0.22
17 0.26
18 0.26
19 0.34
20 0.4
21 0.46
22 0.49
23 0.57
24 0.61
25 0.68
26 0.77
27 0.78
28 0.81
29 0.83
30 0.87
31 0.88
32 0.91
33 0.88
34 0.9
35 0.88
36 0.87
37 0.86
38 0.86
39 0.83
40 0.84
41 0.82
42 0.74
43 0.73
44 0.64
45 0.62
46 0.55
47 0.46
48 0.37
49 0.32
50 0.3
51 0.22
52 0.2
53 0.12
54 0.11
55 0.11
56 0.11
57 0.1
58 0.1
59 0.16
60 0.18
61 0.25
62 0.3
63 0.32
64 0.4
65 0.49
66 0.56
67 0.54
68 0.55
69 0.51
70 0.49
71 0.49
72 0.42
73 0.38
74 0.31
75 0.3
76 0.34
77 0.34
78 0.33
79 0.34
80 0.36
81 0.37
82 0.41
83 0.44
84 0.48
85 0.54
86 0.59
87 0.65
88 0.66
89 0.65
90 0.66
91 0.66
92 0.66
93 0.69
94 0.68
95 0.69