Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MZ99

Protein Details
Accession A0A5M3MZ99   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
175-200QVPSSDEAGRRKRRRVSNKKYGDFVGHydrophilic
NLS Segment(s)
PositionSequence
184-193RRKRRRVSNK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
KEGG cput:CONPUDRAFT_151487  -  
Amino Acid Sequences IKRSQLQDTVNEALQQLEAGADPSTLRLDSKVATQRDRSVAWVLNGWKAINKPEVVRGAFSRCTVRGGFSLSFDSLTSPSALRILREIPRSDPTLWDRISPSIPDAPDVPTVTPADHQDPIELDTPFSGEDFDDDTWQQPNDLMARILNPVDANETTISGPGMVDNVNVDLATVQVPSSDEAGRRKRRRVSNKKYGDFVGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.17
3 0.11
4 0.07
5 0.06
6 0.07
7 0.07
8 0.06
9 0.06
10 0.07
11 0.09
12 0.09
13 0.09
14 0.09
15 0.1
16 0.11
17 0.19
18 0.26
19 0.29
20 0.33
21 0.36
22 0.4
23 0.42
24 0.42
25 0.38
26 0.34
27 0.33
28 0.29
29 0.3
30 0.27
31 0.26
32 0.26
33 0.23
34 0.21
35 0.2
36 0.22
37 0.21
38 0.21
39 0.2
40 0.24
41 0.29
42 0.27
43 0.28
44 0.26
45 0.27
46 0.27
47 0.28
48 0.26
49 0.21
50 0.23
51 0.21
52 0.21
53 0.17
54 0.2
55 0.19
56 0.17
57 0.19
58 0.16
59 0.16
60 0.14
61 0.14
62 0.1
63 0.1
64 0.09
65 0.08
66 0.07
67 0.1
68 0.1
69 0.1
70 0.11
71 0.14
72 0.17
73 0.21
74 0.22
75 0.21
76 0.24
77 0.27
78 0.26
79 0.26
80 0.24
81 0.27
82 0.26
83 0.24
84 0.22
85 0.21
86 0.21
87 0.18
88 0.16
89 0.14
90 0.13
91 0.13
92 0.12
93 0.13
94 0.14
95 0.14
96 0.12
97 0.11
98 0.12
99 0.11
100 0.12
101 0.12
102 0.13
103 0.14
104 0.13
105 0.12
106 0.13
107 0.15
108 0.16
109 0.14
110 0.12
111 0.1
112 0.1
113 0.1
114 0.09
115 0.07
116 0.04
117 0.05
118 0.07
119 0.08
120 0.09
121 0.09
122 0.1
123 0.12
124 0.12
125 0.11
126 0.09
127 0.1
128 0.11
129 0.11
130 0.11
131 0.1
132 0.11
133 0.12
134 0.11
135 0.11
136 0.09
137 0.08
138 0.12
139 0.11
140 0.12
141 0.11
142 0.12
143 0.12
144 0.12
145 0.12
146 0.08
147 0.08
148 0.06
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.07
155 0.06
156 0.06
157 0.05
158 0.06
159 0.06
160 0.06
161 0.05
162 0.05
163 0.07
164 0.08
165 0.1
166 0.12
167 0.16
168 0.24
169 0.35
170 0.45
171 0.52
172 0.6
173 0.67
174 0.76
175 0.83
176 0.86
177 0.87
178 0.87
179 0.9
180 0.87
181 0.83