Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MVM3

Protein Details
Accession A0A5M3MVM3   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-47IDEPPKKKMKKVKAFKLYGVHydrophilic
NLS Segment(s)
PositionSequence
33-40KKKMKKVK
Subcellular Location(s) mito 17.5, mito_nucl 12.666, nucl 6.5, cyto_nucl 4.833
Family & Domain DBs
KEGG cput:CONPUDRAFT_89172  -  
Amino Acid Sequences MSGQRGAIRRKANKVVYVANAEPDIVEIDEPPKKKMKKVKAFKLYGVSFPVIGAMRQEQMPPPPSGLHHPLNPSPSSSLTQPPDEASQVPPPTSGDHCQTSSRKRTLSTVTNVEQHPPTSALYPTQGQQVLTGSVLVHGPKLELNIPSSLVNLRNALEDIEHQGKVLTIQVRALRIQVDVIVQALQCAQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.62
3 0.57
4 0.55
5 0.48
6 0.41
7 0.35
8 0.29
9 0.24
10 0.19
11 0.16
12 0.09
13 0.09
14 0.07
15 0.11
16 0.16
17 0.18
18 0.2
19 0.28
20 0.3
21 0.37
22 0.47
23 0.54
24 0.6
25 0.7
26 0.77
27 0.79
28 0.81
29 0.77
30 0.76
31 0.66
32 0.58
33 0.5
34 0.4
35 0.3
36 0.25
37 0.23
38 0.15
39 0.13
40 0.12
41 0.1
42 0.1
43 0.11
44 0.12
45 0.11
46 0.16
47 0.19
48 0.18
49 0.18
50 0.18
51 0.19
52 0.23
53 0.27
54 0.26
55 0.25
56 0.28
57 0.29
58 0.32
59 0.31
60 0.26
61 0.22
62 0.22
63 0.2
64 0.19
65 0.22
66 0.21
67 0.21
68 0.2
69 0.2
70 0.19
71 0.18
72 0.18
73 0.14
74 0.17
75 0.17
76 0.16
77 0.15
78 0.15
79 0.16
80 0.17
81 0.17
82 0.15
83 0.16
84 0.18
85 0.22
86 0.25
87 0.3
88 0.35
89 0.36
90 0.34
91 0.33
92 0.36
93 0.37
94 0.39
95 0.37
96 0.35
97 0.34
98 0.37
99 0.36
100 0.35
101 0.3
102 0.24
103 0.21
104 0.17
105 0.15
106 0.12
107 0.13
108 0.11
109 0.13
110 0.13
111 0.13
112 0.15
113 0.16
114 0.14
115 0.14
116 0.14
117 0.13
118 0.12
119 0.12
120 0.08
121 0.07
122 0.08
123 0.07
124 0.07
125 0.06
126 0.07
127 0.07
128 0.09
129 0.1
130 0.11
131 0.13
132 0.13
133 0.15
134 0.14
135 0.15
136 0.16
137 0.15
138 0.16
139 0.15
140 0.15
141 0.15
142 0.15
143 0.14
144 0.13
145 0.12
146 0.17
147 0.19
148 0.18
149 0.17
150 0.17
151 0.16
152 0.16
153 0.2
154 0.16
155 0.13
156 0.18
157 0.21
158 0.23
159 0.24
160 0.25
161 0.2
162 0.18
163 0.19
164 0.15
165 0.13
166 0.11
167 0.12
168 0.12
169 0.11
170 0.1