Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MVT1

Protein Details
Accession A0A5M3MVT1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
24-54DEWWRERERRMQRIEKRRKLRKRSCVRGANLBasic
NLS Segment(s)
PositionSequence
30-46RERRMQRIEKRRKLRKR
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
KEGG cput:CONPUDRAFT_136352  -  
Amino Acid Sequences MERQWERAKHAWKSTAGFPFFFTDEWWRERERRMQRIEKRRKLRKRSCVRGANLKREETYASDMEPKYHWRDDSGTLVDEEEMKEKNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.5
4 0.43
5 0.38
6 0.35
7 0.32
8 0.28
9 0.23
10 0.21
11 0.22
12 0.24
13 0.24
14 0.25
15 0.26
16 0.3
17 0.38
18 0.42
19 0.47
20 0.53
21 0.61
22 0.67
23 0.76
24 0.83
25 0.83
26 0.84
27 0.86
28 0.88
29 0.89
30 0.89
31 0.89
32 0.88
33 0.88
34 0.88
35 0.85
36 0.79
37 0.79
38 0.76
39 0.75
40 0.68
41 0.6
42 0.51
43 0.44
44 0.42
45 0.33
46 0.31
47 0.21
48 0.19
49 0.23
50 0.22
51 0.23
52 0.23
53 0.25
54 0.26
55 0.29
56 0.28
57 0.25
58 0.28
59 0.31
60 0.35
61 0.33
62 0.29
63 0.26
64 0.26
65 0.23
66 0.21
67 0.18
68 0.15