Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7SDT6

Protein Details
Accession R7SDT6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-69YKFPMKDRLRRRFQRSYHWYRVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 7, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
KEGG cput:CONPUDRAFT_34899  -  
Amino Acid Sequences LFPCAPSTPTLAVDLRVLRFVDMLALRTAPNVSAWSDTLEAYLLGMGYKFPMKDRLRRRFQRSYHWYRVLDRFSQEHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.2
4 0.19
5 0.16
6 0.15
7 0.14
8 0.15
9 0.12
10 0.13
11 0.11
12 0.11
13 0.11
14 0.11
15 0.12
16 0.08
17 0.08
18 0.07
19 0.08
20 0.08
21 0.09
22 0.1
23 0.1
24 0.1
25 0.09
26 0.08
27 0.07
28 0.06
29 0.06
30 0.04
31 0.03
32 0.03
33 0.03
34 0.04
35 0.05
36 0.06
37 0.07
38 0.17
39 0.21
40 0.3
41 0.41
42 0.5
43 0.6
44 0.69
45 0.77
46 0.77
47 0.79
48 0.81
49 0.81
50 0.8
51 0.8
52 0.78
53 0.72
54 0.68
55 0.72
56 0.66
57 0.59
58 0.54