Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MNR9

Protein Details
Accession A0A5M3MNR9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-41SPNDGKSIKRRKPNHGKPEPBasic
NLS Segment(s)
PositionSequence
26-37GKSIKRRKPNHG
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
KEGG cput:CONPUDRAFT_82850  -  
Amino Acid Sequences MGHCQNITESGAAVKRKQSAESPNDGKSIKRRKPNHGKPEPEYMMLEVPLVYEGEISEVVRMWTLSIPLTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.28
4 0.3
5 0.32
6 0.36
7 0.4
8 0.46
9 0.47
10 0.43
11 0.45
12 0.43
13 0.39
14 0.4
15 0.45
16 0.43
17 0.48
18 0.53
19 0.6
20 0.71
21 0.8
22 0.81
23 0.8
24 0.79
25 0.73
26 0.76
27 0.67
28 0.57
29 0.47
30 0.37
31 0.29
32 0.23
33 0.2
34 0.1
35 0.08
36 0.07
37 0.06
38 0.05
39 0.04
40 0.04
41 0.05
42 0.06
43 0.06
44 0.06
45 0.07
46 0.07
47 0.07
48 0.08
49 0.07
50 0.08
51 0.09