FuNGI

A0A5M3MN09

Protein Details

Accession

A0A5M3MN09

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
476-503	YIDLRVKHLSRKTRRGGRRVIVHRDCRT	Basic
513-533	NNNSTHKGKHIPRSNGRFRLL	Hydrophilic

NLS Segment(s)

Position	Sequence
486-493	RKTRRGGR

Subcellular Location(s)

plas 13, extr 6, E.R. 4, mito 2

Family & Domain DBs

InterPro	View protein in InterPro IPR001128 Cyt_P450 IPR002403 Cyt_P450_E_grp-IV IPR036396 Cyt_P450_sf
Gene Ontology	GO:0016020 C:membrane GO:0020037 F:heme binding GO:0005506 F:iron ion binding GO:0004497 F:monooxygenase activity GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
KEGG	cput:CONPUDRAFT_74281 -
Pfam	View protein in Pfam PF00067 p450

Amino Acid Sequences

MPSFTSCLSTAGHVLLSLGLARLVSPLLFALYNAMKALKQTLDFVYRGPGVAMDRLRLQYGSVCHIMIADRTTTVVSNGGFIKALFSSDILKADVQIVDLVSALSGVEIKRAALADILNHHIHPIAGRFLRKKEFLNEVSPALALSLSTFIKARASVSELHDLSQLVDTALISSISEVIFGPSFPTDIIADLQLLDKTFYPRLCRLPFAGSAFPSARSRLLERLSAYLTRVEGQKLDIWPGYSLVQDYLNVCQLVGISGKNRAALFLSLVWGFTAASTGVTSWMLVFLLNNPQALAKVREEVNSALEVYEGDILRLSGDPNAFDILSFPTIDSAIHETLRLTSVATPSRQAASDIHLSDGHSSVLIKSGDFVMANIRAHHFDPSVYPDPHAFIVDRFSIRNRRRDVPIAFGGGIHACKGRLFAIMHMKIFVVLLTSLAEIELDEKETSNIPKVNQWAVNILRLDQNVSIKLKSRLYIDLRVKHLSRKTRRGGRRVIVHRDCRTSRDDVDDISNNNSTHKGKHIPRSNGRFRLLGETKGVEGEEPVPPPGAPGCERVPPTDCGAAMLRAKDCIERMSPQGKTLQATPRIAVQALVFGAHNVNEMQQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.12
2	0.11
3	0.1
4	0.09
5	0.07
6	0.06
7	0.06
8	0.06
9	0.07
10	0.07
11	0.06
12	0.06
13	0.07
14	0.08
15	0.08
16	0.08
17	0.12
18	0.13
19	0.14
20	0.14
21	0.15
22	0.13
23	0.15
24	0.19
25	0.17
26	0.17
27	0.2
28	0.24
29	0.27
30	0.27
31	0.27
32	0.28
33	0.25
34	0.24
35	0.21
36	0.19
37	0.16
38	0.22
39	0.22
40	0.19
41	0.23
42	0.24
43	0.25
44	0.23
45	0.22
46	0.21
47	0.22
48	0.25
49	0.23
50	0.21
51	0.2
52	0.2
53	0.2
54	0.18
55	0.17
56	0.12
57	0.11
58	0.12
59	0.13
60	0.12
61	0.12
62	0.13
63	0.11
64	0.13
65	0.14
66	0.14
67	0.13
68	0.13
69	0.14
70	0.11
71	0.12
72	0.1
73	0.09
74	0.12
75	0.13
76	0.15
77	0.14
78	0.14
79	0.14
80	0.16
81	0.15
82	0.12
83	0.12
84	0.1
85	0.09
86	0.09
87	0.08
88	0.05
89	0.05
90	0.04
91	0.04
92	0.05
93	0.05
94	0.07
95	0.07
96	0.07
97	0.09
98	0.09
99	0.1
100	0.1
101	0.1
102	0.11
103	0.14
104	0.18
105	0.17
106	0.17
107	0.17
108	0.16
109	0.15
110	0.14
111	0.14
112	0.16
113	0.19
114	0.25
115	0.29
116	0.34
117	0.4
118	0.42
119	0.43
120	0.42
121	0.47
122	0.45
123	0.45
124	0.42
125	0.37
126	0.34
127	0.31
128	0.25
129	0.17
130	0.13
131	0.08
132	0.06
133	0.08
134	0.07
135	0.08
136	0.08
137	0.09
138	0.1
139	0.11
140	0.11
141	0.1
142	0.12
143	0.16
144	0.19
145	0.26
146	0.25
147	0.25
148	0.26
149	0.24
150	0.23
151	0.2
152	0.16
153	0.08
154	0.08
155	0.07
156	0.07
157	0.07
158	0.06
159	0.05
160	0.05
161	0.06
162	0.05
163	0.06
164	0.05
165	0.06
166	0.06
167	0.06
168	0.08
169	0.07
170	0.07
171	0.07
172	0.08
173	0.07
174	0.08
175	0.08
176	0.08
177	0.07
178	0.08
179	0.09
180	0.08
181	0.08
182	0.08
183	0.08
184	0.11
185	0.14
186	0.16
187	0.2
188	0.23
189	0.31
190	0.32
191	0.33
192	0.32
193	0.33
194	0.34
195	0.33
196	0.31
197	0.24
198	0.26
199	0.24
200	0.24
201	0.22
202	0.2
203	0.18
204	0.17
205	0.19
206	0.2
207	0.22
208	0.23
209	0.22
210	0.24
211	0.24
212	0.23
213	0.21
214	0.18
215	0.16
216	0.15
217	0.15
218	0.13
219	0.12
220	0.12
221	0.15
222	0.14
223	0.16
224	0.15
225	0.14
226	0.14
227	0.15
228	0.14
229	0.1
230	0.1
231	0.09
232	0.08
233	0.08
234	0.09
235	0.09
236	0.1
237	0.1
238	0.09
239	0.08
240	0.08
241	0.08
242	0.08
243	0.08
244	0.07
245	0.1
246	0.1
247	0.12
248	0.12
249	0.12
250	0.12
251	0.11
252	0.11
253	0.09
254	0.1
255	0.08
256	0.08
257	0.07
258	0.06
259	0.06
260	0.05
261	0.05
262	0.04
263	0.04
264	0.04
265	0.04
266	0.05
267	0.05
268	0.05
269	0.04
270	0.04
271	0.04
272	0.04
273	0.04
274	0.04
275	0.09
276	0.1
277	0.1
278	0.1
279	0.1
280	0.11
281	0.12
282	0.14
283	0.1
284	0.12
285	0.13
286	0.13
287	0.15
288	0.15
289	0.14
290	0.12
291	0.11
292	0.09
293	0.08
294	0.07
295	0.06
296	0.08
297	0.07
298	0.06
299	0.06
300	0.06
301	0.06
302	0.07
303	0.07
304	0.06
305	0.06
306	0.06
307	0.07
308	0.08
309	0.07
310	0.07
311	0.07
312	0.07
313	0.07
314	0.07
315	0.07
316	0.06
317	0.07
318	0.07
319	0.07
320	0.09
321	0.09
322	0.09
323	0.09
324	0.09
325	0.1
326	0.11
327	0.1
328	0.07
329	0.07
330	0.11
331	0.13
332	0.14
333	0.14
334	0.14
335	0.15
336	0.15
337	0.15
338	0.12
339	0.13
340	0.17
341	0.17
342	0.17
343	0.16
344	0.16
345	0.16
346	0.16
347	0.12
348	0.08
349	0.08
350	0.06
351	0.1
352	0.1
353	0.09
354	0.09
355	0.09
356	0.1
357	0.09
358	0.09
359	0.08
360	0.11
361	0.11
362	0.12
363	0.13
364	0.14
365	0.14
366	0.16
367	0.13
368	0.11
369	0.12
370	0.19
371	0.24
372	0.23
373	0.23
374	0.22
375	0.23
376	0.23
377	0.22
378	0.15
379	0.1
380	0.12
381	0.14
382	0.14
383	0.14
384	0.18
385	0.27
386	0.32
387	0.4
388	0.42
389	0.45
390	0.49
391	0.56
392	0.53
393	0.5
394	0.48
395	0.42
396	0.37
397	0.31
398	0.27
399	0.2
400	0.18
401	0.12
402	0.1
403	0.08
404	0.08
405	0.09
406	0.09
407	0.12
408	0.12
409	0.16
410	0.25
411	0.28
412	0.28
413	0.27
414	0.26
415	0.23
416	0.22
417	0.17
418	0.08
419	0.05
420	0.06
421	0.06
422	0.06
423	0.05
424	0.05
425	0.05
426	0.04
427	0.06
428	0.06
429	0.07
430	0.07
431	0.08
432	0.09
433	0.11
434	0.13
435	0.16
436	0.18
437	0.17
438	0.21
439	0.25
440	0.29
441	0.29
442	0.29
443	0.3
444	0.29
445	0.33
446	0.29
447	0.27
448	0.25
449	0.23
450	0.24
451	0.2
452	0.21
453	0.2
454	0.22
455	0.22
456	0.23
457	0.28
458	0.29
459	0.28
460	0.29
461	0.32
462	0.35
463	0.43
464	0.48
465	0.49
466	0.51
467	0.55
468	0.53
469	0.53
470	0.56
471	0.57
472	0.59
473	0.62
474	0.67
475	0.72
476	0.8
477	0.82
478	0.84
479	0.81
480	0.82
481	0.81
482	0.82
483	0.81
484	0.8
485	0.77
486	0.76
487	0.7
488	0.63
489	0.59
490	0.53
491	0.47
492	0.44
493	0.4
494	0.33
495	0.37
496	0.37
497	0.34
498	0.33
499	0.34
500	0.27
501	0.27
502	0.3
503	0.26
504	0.25
505	0.29
506	0.35
507	0.39
508	0.49
509	0.58
510	0.63
511	0.72
512	0.8
513	0.83
514	0.82
515	0.77
516	0.69
517	0.61
518	0.62
519	0.55
520	0.47
521	0.41
522	0.34
523	0.31
524	0.3
525	0.28
526	0.18
527	0.16
528	0.16
529	0.16
530	0.15
531	0.16
532	0.16
533	0.15
534	0.17
535	0.17
536	0.19
537	0.17
538	0.21
539	0.23
540	0.28
541	0.3
542	0.33
543	0.35
544	0.33
545	0.36
546	0.34
547	0.31
548	0.28
549	0.28
550	0.29
551	0.29
552	0.3
553	0.26
554	0.25
555	0.26
556	0.26
557	0.25
558	0.25
559	0.25
560	0.25
561	0.32
562	0.37
563	0.37
564	0.37
565	0.41
566	0.39
567	0.38
568	0.41
569	0.44
570	0.43
571	0.45
572	0.43
573	0.43
574	0.42
575	0.4
576	0.35
577	0.26
578	0.22
579	0.19
580	0.19
581	0.14
582	0.12
583	0.13
584	0.12
585	0.13

A0A5M3MN09

3D AlphaFold-predicted Structure Viewer