Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2VWQ8

Protein Details
Accession B2VWQ8    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
161-185MTPKTPTTPKTPKRRKGLQMKTAAMHydrophilic
NLS Segment(s)
PositionSequence
170-178KTPKRRKGL
192-214EKARKVVSNVKLQRILGRKWKKR
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
Amino Acid Sequences MAPSHTPTGARRTGPSPSQENKSHSAKTGAGVAPHKTRFMNQPAKRDEQRRESKRFVTIPPLEKLEFVYGHPNGAPTSPTAGPRGPQGPANPANDTAAAGTGKDTSVAIKKEDGDGIAAASTGKETSAYIKKEEGVGEGEDGIAGEPAEGKGAGQVPTPPMTPKTPTTPKTPKRRKGLQMKTAAMPPEDSPEKARKVVSNVKLQRILGRKWKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.47
4 0.47
5 0.52
6 0.55
7 0.56
8 0.56
9 0.57
10 0.53
11 0.47
12 0.46
13 0.39
14 0.34
15 0.37
16 0.31
17 0.3
18 0.3
19 0.32
20 0.35
21 0.35
22 0.36
23 0.29
24 0.31
25 0.34
26 0.41
27 0.48
28 0.46
29 0.54
30 0.58
31 0.65
32 0.69
33 0.69
34 0.67
35 0.67
36 0.72
37 0.71
38 0.73
39 0.71
40 0.68
41 0.68
42 0.64
43 0.56
44 0.55
45 0.54
46 0.51
47 0.47
48 0.47
49 0.39
50 0.36
51 0.34
52 0.28
53 0.21
54 0.17
55 0.21
56 0.17
57 0.18
58 0.18
59 0.17
60 0.14
61 0.14
62 0.13
63 0.08
64 0.12
65 0.12
66 0.13
67 0.15
68 0.15
69 0.15
70 0.18
71 0.19
72 0.16
73 0.17
74 0.17
75 0.21
76 0.25
77 0.27
78 0.25
79 0.24
80 0.23
81 0.21
82 0.2
83 0.13
84 0.1
85 0.07
86 0.06
87 0.06
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.09
94 0.1
95 0.11
96 0.11
97 0.12
98 0.12
99 0.13
100 0.12
101 0.09
102 0.08
103 0.07
104 0.06
105 0.05
106 0.04
107 0.04
108 0.04
109 0.03
110 0.03
111 0.03
112 0.04
113 0.09
114 0.15
115 0.16
116 0.18
117 0.19
118 0.19
119 0.21
120 0.21
121 0.17
122 0.13
123 0.12
124 0.11
125 0.1
126 0.1
127 0.08
128 0.07
129 0.06
130 0.04
131 0.03
132 0.03
133 0.03
134 0.04
135 0.04
136 0.04
137 0.04
138 0.06
139 0.08
140 0.09
141 0.09
142 0.11
143 0.12
144 0.14
145 0.15
146 0.15
147 0.16
148 0.18
149 0.22
150 0.24
151 0.31
152 0.38
153 0.4
154 0.48
155 0.56
156 0.62
157 0.7
158 0.78
159 0.78
160 0.78
161 0.86
162 0.86
163 0.86
164 0.88
165 0.86
166 0.85
167 0.8
168 0.73
169 0.67
170 0.59
171 0.48
172 0.4
173 0.31
174 0.29
175 0.28
176 0.26
177 0.27
178 0.32
179 0.35
180 0.36
181 0.39
182 0.35
183 0.41
184 0.5
185 0.52
186 0.56
187 0.58
188 0.63
189 0.64
190 0.61
191 0.61
192 0.58
193 0.58
194 0.58