Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MVX8

Protein Details
Accession A0A5M3MVX8    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-87APRPPAEEEKPKPHHKKKHEKKPSKPSPEPVQQABasic
NLS Segment(s)
PositionSequence
59-79AEEEKPKPHHKKKHEKKPSKP
Subcellular Location(s) cyto 13.5, cyto_nucl 12.333, nucl 10, mito_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013899  DUF1771  
IPR002625  Smr_dom  
IPR036063  Smr_dom_sf  
KEGG cput:CONPUDRAFT_121835  -  
Pfam View protein in Pfam  
PF08590  DUF1771  
PF01713  Smr  
PROSITE View protein in PROSITE  
PS50828  SMR  
Amino Acid Sequences MPGFGDFIIGLIQALCGGQSSKDQAQQIDQPYQGRPSAPGYTAYPPPQASQAEAPRPPAEEEKPKPHHKKKHEKKPSKPSPEPVQQAPFESHVIPPEKHHSGDPNQVNQHNEHYMSLRAQANEAGDKMSKCFQESHEAYSNGNGARAKELSNEGKRNEAEMQRLNKEASEWIFQANNTDSQPGEVDLHGLYVKEAISFSDKAIKDARARGDAEIRLIVGKGLHSEGHVAKIKPALEELMKQHNVPTEVDPKNAGVLIVHLDLSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.05
4 0.06
5 0.06
6 0.09
7 0.15
8 0.19
9 0.24
10 0.27
11 0.27
12 0.31
13 0.37
14 0.39
15 0.38
16 0.37
17 0.35
18 0.35
19 0.37
20 0.34
21 0.28
22 0.25
23 0.25
24 0.26
25 0.25
26 0.25
27 0.25
28 0.28
29 0.32
30 0.33
31 0.32
32 0.29
33 0.29
34 0.31
35 0.28
36 0.27
37 0.29
38 0.33
39 0.36
40 0.37
41 0.39
42 0.36
43 0.37
44 0.36
45 0.34
46 0.33
47 0.36
48 0.41
49 0.48
50 0.55
51 0.63
52 0.72
53 0.76
54 0.81
55 0.82
56 0.87
57 0.88
58 0.91
59 0.93
60 0.92
61 0.93
62 0.94
63 0.94
64 0.93
65 0.88
66 0.84
67 0.82
68 0.8
69 0.74
70 0.67
71 0.61
72 0.51
73 0.47
74 0.41
75 0.34
76 0.27
77 0.23
78 0.19
79 0.18
80 0.21
81 0.19
82 0.2
83 0.24
84 0.25
85 0.25
86 0.26
87 0.26
88 0.27
89 0.35
90 0.37
91 0.36
92 0.38
93 0.39
94 0.39
95 0.35
96 0.35
97 0.27
98 0.24
99 0.19
100 0.17
101 0.16
102 0.14
103 0.18
104 0.16
105 0.15
106 0.15
107 0.15
108 0.14
109 0.14
110 0.14
111 0.1
112 0.1
113 0.1
114 0.1
115 0.13
116 0.12
117 0.12
118 0.14
119 0.14
120 0.22
121 0.23
122 0.27
123 0.29
124 0.3
125 0.29
126 0.28
127 0.29
128 0.19
129 0.2
130 0.15
131 0.1
132 0.12
133 0.12
134 0.12
135 0.11
136 0.16
137 0.21
138 0.26
139 0.3
140 0.29
141 0.32
142 0.32
143 0.33
144 0.34
145 0.29
146 0.28
147 0.3
148 0.34
149 0.31
150 0.33
151 0.3
152 0.26
153 0.24
154 0.22
155 0.18
156 0.16
157 0.15
158 0.15
159 0.16
160 0.15
161 0.18
162 0.17
163 0.17
164 0.14
165 0.15
166 0.13
167 0.13
168 0.14
169 0.12
170 0.11
171 0.09
172 0.09
173 0.08
174 0.09
175 0.09
176 0.08
177 0.07
178 0.07
179 0.07
180 0.06
181 0.06
182 0.07
183 0.1
184 0.11
185 0.12
186 0.19
187 0.19
188 0.21
189 0.25
190 0.28
191 0.28
192 0.33
193 0.36
194 0.32
195 0.34
196 0.34
197 0.36
198 0.33
199 0.31
200 0.26
201 0.22
202 0.18
203 0.17
204 0.15
205 0.1
206 0.09
207 0.09
208 0.1
209 0.1
210 0.1
211 0.14
212 0.14
213 0.21
214 0.26
215 0.24
216 0.25
217 0.29
218 0.3
219 0.26
220 0.27
221 0.23
222 0.2
223 0.25
224 0.27
225 0.33
226 0.33
227 0.32
228 0.34
229 0.35
230 0.35
231 0.32
232 0.33
233 0.33
234 0.34
235 0.36
236 0.35
237 0.3
238 0.3
239 0.28
240 0.23
241 0.13
242 0.12
243 0.14
244 0.13