Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7SE51

Protein Details
Accession R7SE51    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-59KSAKKSTKPSAKKQKQANPPMTHydrophilic
NLS Segment(s)
PositionSequence
37-51EKSAKKSTKPSAKKQ
Subcellular Location(s) nucl 14.5, mito_nucl 11, mito 6.5, cyto 3
Family & Domain DBs
KEGG cput:CONPUDRAFT_160387  -  
Amino Acid Sequences MSQDFINKRFDEFTKVSGRICILVATTIASNERKDAEKSAKKSTKPSAKKQKQANPPMTATADPSNSEDQPEHVPEVSSYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.35
4 0.33
5 0.32
6 0.25
7 0.24
8 0.18
9 0.11
10 0.1
11 0.1
12 0.09
13 0.08
14 0.07
15 0.09
16 0.1
17 0.1
18 0.1
19 0.12
20 0.13
21 0.14
22 0.18
23 0.25
24 0.31
25 0.35
26 0.44
27 0.47
28 0.47
29 0.52
30 0.56
31 0.57
32 0.58
33 0.65
34 0.66
35 0.7
36 0.76
37 0.8
38 0.8
39 0.8
40 0.83
41 0.8
42 0.73
43 0.66
44 0.61
45 0.54
46 0.45
47 0.38
48 0.31
49 0.25
50 0.21
51 0.23
52 0.23
53 0.21
54 0.23
55 0.2
56 0.2
57 0.23
58 0.24
59 0.24
60 0.21
61 0.21