Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3N0Z5

Protein Details
Accession A0A5M3N0Z5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-71RTQAKARGSQRKKEKVRHGMCIDHydrophilic
NLS Segment(s)
PositionSequence
52-63AKARGSQRKKEK
Subcellular Location(s) nucl 14, cyto_nucl 10, pero 5, cyto 4, mito 3
Family & Domain DBs
KEGG cput:CONPUDRAFT_88716  -  
Amino Acid Sequences MELDEPTRERQSLIGRRWIHQDRPITDAEPRVTSSERLVRATASARPQRTQAKARGSQRKKEKVRHGMCIDARMDLWAHVRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.47
4 0.56
5 0.57
6 0.52
7 0.5
8 0.53
9 0.45
10 0.47
11 0.46
12 0.38
13 0.34
14 0.33
15 0.29
16 0.22
17 0.21
18 0.2
19 0.2
20 0.19
21 0.2
22 0.21
23 0.21
24 0.21
25 0.2
26 0.18
27 0.18
28 0.19
29 0.19
30 0.2
31 0.24
32 0.25
33 0.25
34 0.3
35 0.35
36 0.39
37 0.43
38 0.43
39 0.46
40 0.52
41 0.6
42 0.67
43 0.66
44 0.7
45 0.74
46 0.77
47 0.77
48 0.8
49 0.81
50 0.81
51 0.81
52 0.82
53 0.75
54 0.73
55 0.67
56 0.62
57 0.52
58 0.42
59 0.37
60 0.28
61 0.25
62 0.18