Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3N149

Protein Details
Accession A0A5M3N149    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-52YEMYTDSRGRQKRRRRQIPPGLSARDHydrophilic
NLS Segment(s)
PositionSequence
35-47GRQKRRRRQIPPG
230-233KKKG
Subcellular Location(s) nucl 9.5, cyto_nucl 8.5, cyto 6.5, mito 5, plas 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025187  DUF4112  
KEGG cput:CONPUDRAFT_48484  -  
Pfam View protein in Pfam  
PF13430  DUF4112  
Amino Acid Sequences MESLLQSQGTKLFRKHLQQYAPEDPMYEMYTDSRGRQKRRRRQIPPGLSARDAKILKSVQRRAHYLDKGFSVCGFKFGWTAIIGIIPGAGDVADVGLNYFLVVRKARQADLPWWLVRQMLLNNAVSACVGLIPIGGDLVLAMYKANSRNAALLEEFLRIRGEEFLKVQAKEQEGGQRPTADAPPQNDIEQVNPGHGMPGGLAAASSADVPPKGASRNISFTSWRNGMKDKKKGKAPDTPPVGDRGKFVEDVGPNASPDNPTVEKKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.54
3 0.57
4 0.61
5 0.63
6 0.69
7 0.69
8 0.66
9 0.57
10 0.5
11 0.42
12 0.37
13 0.3
14 0.23
15 0.16
16 0.13
17 0.18
18 0.18
19 0.21
20 0.28
21 0.35
22 0.44
23 0.53
24 0.63
25 0.69
26 0.79
27 0.87
28 0.87
29 0.9
30 0.92
31 0.92
32 0.89
33 0.87
34 0.8
35 0.72
36 0.65
37 0.55
38 0.52
39 0.42
40 0.34
41 0.31
42 0.31
43 0.35
44 0.41
45 0.48
46 0.47
47 0.52
48 0.55
49 0.55
50 0.6
51 0.59
52 0.53
53 0.49
54 0.44
55 0.41
56 0.37
57 0.33
58 0.28
59 0.21
60 0.2
61 0.18
62 0.15
63 0.14
64 0.14
65 0.14
66 0.11
67 0.11
68 0.08
69 0.08
70 0.07
71 0.06
72 0.06
73 0.04
74 0.03
75 0.03
76 0.03
77 0.02
78 0.02
79 0.02
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.04
87 0.04
88 0.06
89 0.07
90 0.08
91 0.14
92 0.16
93 0.16
94 0.18
95 0.2
96 0.21
97 0.25
98 0.28
99 0.23
100 0.22
101 0.21
102 0.19
103 0.17
104 0.16
105 0.12
106 0.11
107 0.13
108 0.12
109 0.12
110 0.12
111 0.12
112 0.09
113 0.08
114 0.05
115 0.03
116 0.03
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.05
131 0.06
132 0.07
133 0.08
134 0.09
135 0.1
136 0.11
137 0.12
138 0.11
139 0.1
140 0.1
141 0.11
142 0.1
143 0.1
144 0.09
145 0.08
146 0.08
147 0.1
148 0.11
149 0.11
150 0.12
151 0.18
152 0.21
153 0.22
154 0.23
155 0.24
156 0.24
157 0.23
158 0.24
159 0.26
160 0.28
161 0.3
162 0.3
163 0.27
164 0.26
165 0.27
166 0.27
167 0.22
168 0.2
169 0.2
170 0.22
171 0.23
172 0.23
173 0.22
174 0.21
175 0.19
176 0.2
177 0.17
178 0.14
179 0.13
180 0.13
181 0.12
182 0.11
183 0.1
184 0.06
185 0.06
186 0.06
187 0.05
188 0.05
189 0.04
190 0.04
191 0.04
192 0.05
193 0.04
194 0.05
195 0.06
196 0.07
197 0.08
198 0.1
199 0.12
200 0.15
201 0.19
202 0.22
203 0.29
204 0.3
205 0.32
206 0.33
207 0.34
208 0.38
209 0.39
210 0.37
211 0.34
212 0.4
213 0.47
214 0.53
215 0.61
216 0.63
217 0.66
218 0.72
219 0.77
220 0.76
221 0.77
222 0.74
223 0.74
224 0.73
225 0.68
226 0.6
227 0.58
228 0.56
229 0.46
230 0.4
231 0.35
232 0.3
233 0.28
234 0.27
235 0.27
236 0.25
237 0.27
238 0.29
239 0.25
240 0.22
241 0.23
242 0.23
243 0.18
244 0.17
245 0.21
246 0.22
247 0.25