Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3N0N6

Protein Details
Accession A0A5M3N0N6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
37-62VTRGQGFRKEKNKKKRGSYRGGEITVHydrophilic
NLS Segment(s)
PositionSequence
43-54FRKEKNKKKRGS
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
KEGG cput:CONPUDRAFT_39225  -  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences RIRDEHMDQDKWINNAYDAKGGITNDYGERASKDLIVTRGQGFRKEKNKKKRGSYRGGEITVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.27
4 0.23
5 0.19
6 0.19
7 0.18
8 0.18
9 0.16
10 0.13
11 0.12
12 0.1
13 0.11
14 0.1
15 0.09
16 0.09
17 0.1
18 0.09
19 0.09
20 0.09
21 0.1
22 0.12
23 0.13
24 0.14
25 0.15
26 0.2
27 0.21
28 0.27
29 0.29
30 0.36
31 0.45
32 0.54
33 0.62
34 0.68
35 0.77
36 0.79
37 0.86
38 0.88
39 0.88
40 0.87
41 0.85
42 0.83
43 0.82
44 0.77