Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3MBV1

Protein Details
Accession A0A5M3MBV1    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-122PLDLRPKKTRAIRRRLTKNEAASKTEKQRKKDIHFPLRKYAVHydrophilic
NLS Segment(s)
PositionSequence
84-114LRPKKTRAIRRRLTKNEAASKTEKQRKKDIH
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG cput:CONPUDRAFT_84797  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKTKNDLKKQLDELKNELLTLRVQKVAGGSASKLTKINIVRKSIARVLTVMNQKTRQNLRQLYKNKKYLPLDLRPKKTRAIRRRLTKNEAASKTEKQRKKDIHFPLRKYAVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.58
3 0.56
4 0.62
5 0.59
6 0.6
7 0.64
8 0.69
9 0.68
10 0.64
11 0.62
12 0.57
13 0.51
14 0.44
15 0.36
16 0.27
17 0.23
18 0.23
19 0.2
20 0.16
21 0.15
22 0.16
23 0.16
24 0.16
25 0.15
26 0.12
27 0.11
28 0.13
29 0.14
30 0.14
31 0.14
32 0.13
33 0.17
34 0.21
35 0.29
36 0.3
37 0.33
38 0.35
39 0.35
40 0.39
41 0.37
42 0.34
43 0.26
44 0.22
45 0.2
46 0.23
47 0.27
48 0.25
49 0.24
50 0.25
51 0.26
52 0.31
53 0.35
54 0.32
55 0.35
56 0.41
57 0.43
58 0.49
59 0.57
60 0.62
61 0.65
62 0.69
63 0.64
64 0.65
65 0.63
66 0.63
67 0.61
68 0.6
69 0.63
70 0.64
71 0.7
72 0.67
73 0.66
74 0.65
75 0.67
76 0.68
77 0.67
78 0.69
79 0.7
80 0.75
81 0.84
82 0.85
83 0.84
84 0.81
85 0.8
86 0.79
87 0.73
88 0.69
89 0.63
90 0.62
91 0.64
92 0.67
93 0.64
94 0.59
95 0.66
96 0.7
97 0.73
98 0.75
99 0.76
100 0.77
101 0.81
102 0.81
103 0.81
104 0.8