Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M3N2H3

Protein Details
Accession A0A5M3N2H3    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
276-303RGFERHSSRYDDRRRDRERSRSPGRRRYBasic
NLS Segment(s)
PositionSequence
237-303REKRKQAPPSGVPAATGPPGRGGERGSEHRPSRDDRERDRGFERHSSRYDDRRRDRERSRSPGRRRY
Subcellular Location(s) cyto_nucl 9.5, nucl 9, mito 9, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004882  Luc7-rel  
Gene Ontology GO:0005685  C:U1 snRNP  
GO:0003729  F:mRNA binding  
GO:0006376  P:mRNA splice site selection  
KEGG cput:CONPUDRAFT_79783  -  
Pfam View protein in Pfam  
PF03194  LUC7  
Amino Acid Sequences MGRLAEMQRKLLEQMMGPEAMGVANANLVWSDDKVCRNFLCGTCPHALFTNTKMDLGACPKSHTERLKTEFLAAREANPTDPVFHRFQMEYEANIFAFVDECDRRIRAAHRRLEKTPEENAKTTNLMREIAEIELAIQGGTEKIETLGEQGKVDESMREMAAIEALKSEKSDKERELQQLTDTSGASGHQKLRVCDVCGAYLSVLDSDRRLADHFGGKMHLGYHELRNMLAKFREDREKRKQAPPSGVPAATGPPGRGGERGSEHRPSRDDRERDRGFERHSSRYDDRRRDRERSRSPGRRRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.22
4 0.21
5 0.19
6 0.15
7 0.13
8 0.12
9 0.07
10 0.04
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.07
17 0.08
18 0.11
19 0.15
20 0.21
21 0.23
22 0.27
23 0.26
24 0.29
25 0.33
26 0.32
27 0.33
28 0.29
29 0.33
30 0.34
31 0.34
32 0.32
33 0.29
34 0.3
35 0.26
36 0.27
37 0.31
38 0.27
39 0.26
40 0.25
41 0.23
42 0.24
43 0.27
44 0.29
45 0.21
46 0.23
47 0.26
48 0.31
49 0.38
50 0.41
51 0.42
52 0.45
53 0.49
54 0.52
55 0.5
56 0.51
57 0.48
58 0.42
59 0.43
60 0.34
61 0.31
62 0.28
63 0.28
64 0.23
65 0.21
66 0.21
67 0.17
68 0.19
69 0.21
70 0.21
71 0.21
72 0.23
73 0.21
74 0.21
75 0.25
76 0.24
77 0.21
78 0.2
79 0.2
80 0.17
81 0.16
82 0.16
83 0.09
84 0.08
85 0.07
86 0.09
87 0.08
88 0.1
89 0.12
90 0.12
91 0.13
92 0.15
93 0.22
94 0.28
95 0.36
96 0.43
97 0.5
98 0.55
99 0.57
100 0.62
101 0.59
102 0.53
103 0.52
104 0.53
105 0.47
106 0.43
107 0.42
108 0.36
109 0.34
110 0.31
111 0.26
112 0.19
113 0.16
114 0.15
115 0.15
116 0.14
117 0.12
118 0.11
119 0.08
120 0.07
121 0.06
122 0.06
123 0.05
124 0.03
125 0.03
126 0.03
127 0.04
128 0.03
129 0.03
130 0.03
131 0.03
132 0.04
133 0.05
134 0.08
135 0.09
136 0.09
137 0.09
138 0.09
139 0.1
140 0.1
141 0.08
142 0.06
143 0.07
144 0.07
145 0.07
146 0.07
147 0.06
148 0.07
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.08
156 0.1
157 0.14
158 0.18
159 0.19
160 0.24
161 0.3
162 0.35
163 0.36
164 0.33
165 0.3
166 0.28
167 0.27
168 0.24
169 0.18
170 0.13
171 0.1
172 0.1
173 0.11
174 0.12
175 0.13
176 0.16
177 0.18
178 0.18
179 0.25
180 0.27
181 0.27
182 0.28
183 0.27
184 0.24
185 0.22
186 0.22
187 0.15
188 0.13
189 0.11
190 0.08
191 0.08
192 0.07
193 0.07
194 0.08
195 0.08
196 0.09
197 0.1
198 0.1
199 0.13
200 0.17
201 0.17
202 0.17
203 0.18
204 0.17
205 0.17
206 0.16
207 0.14
208 0.12
209 0.14
210 0.16
211 0.18
212 0.18
213 0.18
214 0.22
215 0.22
216 0.23
217 0.23
218 0.23
219 0.24
220 0.28
221 0.38
222 0.4
223 0.48
224 0.55
225 0.63
226 0.66
227 0.72
228 0.76
229 0.73
230 0.77
231 0.72
232 0.69
233 0.64
234 0.57
235 0.49
236 0.41
237 0.36
238 0.29
239 0.26
240 0.18
241 0.16
242 0.18
243 0.19
244 0.19
245 0.18
246 0.2
247 0.26
248 0.32
249 0.33
250 0.4
251 0.42
252 0.46
253 0.49
254 0.5
255 0.53
256 0.57
257 0.61
258 0.6
259 0.68
260 0.67
261 0.68
262 0.68
263 0.65
264 0.6
265 0.61
266 0.59
267 0.57
268 0.56
269 0.59
270 0.61
271 0.65
272 0.7
273 0.71
274 0.76
275 0.78
276 0.82
277 0.83
278 0.86
279 0.86
280 0.86
281 0.86
282 0.87
283 0.87