Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MHP4

Protein Details
Accession A0A5M3MHP4    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
134-155NAEKETKKSIRRQKKENPDEPVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto_nucl 8.5, cyto 7, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR022967  S1_dom  
IPR003029  S1_domain  
IPR044126  S1_IF2_alpha  
IPR024055  TIF2_asu_C  
IPR024054  TIF2_asu_middle_sf  
IPR011488  TIF_2_asu  
Gene Ontology GO:0003723  F:RNA binding  
GO:0003743  F:translation initiation factor activity  
KEGG cput:CONPUDRAFT_84010  -  
Pfam View protein in Pfam  
PF07541  EIF_2_alpha  
PF00575  S1  
PROSITE View protein in PROSITE  
PS50126  S1  
CDD cd04452  S1_IF2_alpha  
Amino Acid Sequences MRYYEQRYPEVDELVMVQVRQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGRNEVVVVLRVDREKGYIDLSKRRVSPEDITKCEERYNKSKAVASIMRHVASKLPSIDAETSIPVPSEDPAVENAEKETKKSIRRQKKENPDEPVDDIVMGGPNEEEKLEKLYEQIAWPLGHKYGHPYDAFKVALTEQESVFSSLATPVPTSTLSILTGTIARRLTPQPIKLRADIELTCYTPAGIDAIKKALRAGEKESNDTVPIKAKLVAPPLYVLSTNATDKYAAVDRLERAIESIQAKIEEKGGSLVVKMKPKAVSETEEQDLAQLMAKAGQENAEVSGDEEEEEVIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.16
4 0.13
5 0.14
6 0.14
7 0.14
8 0.13
9 0.09
10 0.08
11 0.1
12 0.11
13 0.08
14 0.08
15 0.08
16 0.08
17 0.09
18 0.09
19 0.09
20 0.1
21 0.12
22 0.12
23 0.12
24 0.12
25 0.11
26 0.1
27 0.1
28 0.07
29 0.05
30 0.05
31 0.08
32 0.1
33 0.16
34 0.21
35 0.22
36 0.27
37 0.35
38 0.44
39 0.52
40 0.61
41 0.64
42 0.69
43 0.76
44 0.76
45 0.76
46 0.71
47 0.64
48 0.56
49 0.49
50 0.4
51 0.32
52 0.27
53 0.21
54 0.18
55 0.15
56 0.15
57 0.14
58 0.15
59 0.14
60 0.14
61 0.14
62 0.15
63 0.18
64 0.2
65 0.25
66 0.32
67 0.36
68 0.4
69 0.4
70 0.43
71 0.42
72 0.41
73 0.44
74 0.46
75 0.5
76 0.48
77 0.51
78 0.5
79 0.48
80 0.49
81 0.47
82 0.42
83 0.41
84 0.43
85 0.43
86 0.44
87 0.47
88 0.42
89 0.44
90 0.43
91 0.38
92 0.39
93 0.37
94 0.35
95 0.32
96 0.31
97 0.27
98 0.23
99 0.24
100 0.18
101 0.16
102 0.15
103 0.17
104 0.18
105 0.16
106 0.15
107 0.13
108 0.13
109 0.11
110 0.11
111 0.09
112 0.09
113 0.07
114 0.08
115 0.07
116 0.07
117 0.08
118 0.12
119 0.12
120 0.12
121 0.13
122 0.18
123 0.18
124 0.18
125 0.22
126 0.24
127 0.31
128 0.4
129 0.49
130 0.54
131 0.62
132 0.71
133 0.75
134 0.8
135 0.84
136 0.82
137 0.78
138 0.72
139 0.67
140 0.59
141 0.5
142 0.38
143 0.28
144 0.2
145 0.14
146 0.1
147 0.07
148 0.06
149 0.04
150 0.04
151 0.04
152 0.05
153 0.05
154 0.04
155 0.07
156 0.07
157 0.07
158 0.08
159 0.09
160 0.1
161 0.1
162 0.1
163 0.1
164 0.1
165 0.11
166 0.11
167 0.11
168 0.1
169 0.1
170 0.14
171 0.14
172 0.17
173 0.17
174 0.18
175 0.18
176 0.21
177 0.21
178 0.16
179 0.15
180 0.12
181 0.14
182 0.13
183 0.13
184 0.1
185 0.11
186 0.12
187 0.12
188 0.12
189 0.09
190 0.08
191 0.08
192 0.09
193 0.08
194 0.07
195 0.06
196 0.08
197 0.08
198 0.08
199 0.08
200 0.08
201 0.08
202 0.08
203 0.08
204 0.07
205 0.1
206 0.09
207 0.12
208 0.11
209 0.11
210 0.14
211 0.16
212 0.23
213 0.26
214 0.32
215 0.37
216 0.44
217 0.47
218 0.46
219 0.46
220 0.4
221 0.39
222 0.32
223 0.29
224 0.24
225 0.22
226 0.2
227 0.18
228 0.16
229 0.12
230 0.12
231 0.08
232 0.07
233 0.07
234 0.08
235 0.12
236 0.13
237 0.13
238 0.14
239 0.16
240 0.19
241 0.2
242 0.26
243 0.3
244 0.32
245 0.35
246 0.37
247 0.34
248 0.33
249 0.31
250 0.26
251 0.23
252 0.22
253 0.2
254 0.21
255 0.22
256 0.24
257 0.29
258 0.3
259 0.25
260 0.25
261 0.25
262 0.24
263 0.21
264 0.18
265 0.15
266 0.16
267 0.16
268 0.16
269 0.15
270 0.14
271 0.14
272 0.17
273 0.18
274 0.17
275 0.17
276 0.2
277 0.2
278 0.23
279 0.24
280 0.2
281 0.17
282 0.17
283 0.2
284 0.18
285 0.18
286 0.17
287 0.18
288 0.2
289 0.19
290 0.21
291 0.17
292 0.16
293 0.16
294 0.16
295 0.14
296 0.14
297 0.2
298 0.21
299 0.28
300 0.29
301 0.32
302 0.34
303 0.36
304 0.41
305 0.39
306 0.39
307 0.36
308 0.41
309 0.38
310 0.36
311 0.33
312 0.27
313 0.24
314 0.2
315 0.17
316 0.12
317 0.1
318 0.12
319 0.13
320 0.14
321 0.13
322 0.14
323 0.13
324 0.13
325 0.15
326 0.13
327 0.12
328 0.12
329 0.13
330 0.12
331 0.11
332 0.11