Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MCG2

Protein Details
Accession A0A5M3MCG2    Localization Confidence High Confidence Score 19.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-38TIPHVDSRPKLKRKKPEYPPLEFEHydrophilic
45-71QPVTGTKPRKPPKQPLRRVKRRFWTNYHydrophilic
NLS Segment(s)
PositionSequence
24-29KLKRKK
51-66KPRKPPKQPLRRVKRR
Subcellular Location(s) nucl 21, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
KEGG cput:CONPUDRAFT_76336  -  
Amino Acid Sequences MAPAPVDTLLQKTDTIPHVDSRPKLKRKKPEYPPLEFEDNDGGDQPVTGTKPRKPPKQPLRRVKRRFWTNYSYEELNNKDNEGDNEGYLSAEEDVDERWQTFIRQRAMRSIAKRAKCACD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.22
4 0.25
5 0.29
6 0.34
7 0.38
8 0.43
9 0.5
10 0.55
11 0.64
12 0.68
13 0.74
14 0.78
15 0.84
16 0.85
17 0.85
18 0.83
19 0.81
20 0.77
21 0.72
22 0.67
23 0.56
24 0.48
25 0.41
26 0.33
27 0.26
28 0.21
29 0.15
30 0.11
31 0.1
32 0.09
33 0.07
34 0.07
35 0.11
36 0.14
37 0.18
38 0.29
39 0.37
40 0.46
41 0.51
42 0.62
43 0.69
44 0.77
45 0.82
46 0.83
47 0.86
48 0.88
49 0.88
50 0.86
51 0.85
52 0.83
53 0.8
54 0.75
55 0.71
56 0.64
57 0.61
58 0.56
59 0.48
60 0.39
61 0.36
62 0.33
63 0.29
64 0.25
65 0.21
66 0.18
67 0.18
68 0.18
69 0.19
70 0.17
71 0.14
72 0.14
73 0.14
74 0.13
75 0.11
76 0.11
77 0.06
78 0.05
79 0.05
80 0.05
81 0.06
82 0.08
83 0.09
84 0.09
85 0.1
86 0.11
87 0.13
88 0.19
89 0.25
90 0.32
91 0.36
92 0.37
93 0.44
94 0.5
95 0.55
96 0.54
97 0.58
98 0.59
99 0.59
100 0.65