Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MA25

Protein Details
Accession A0A5M3MA25    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
99-118EKAQLKKDRQQRIKDANFMKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG cput:CONPUDRAFT_147055  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFFRSALRRTATLSRSARSYATKIPAEPVTEGATVAAQATPKVPLNVSSCPANTVLTGLNYLKGQPPVIALPDEEYPPWLWDIQKPKVLPDDGPGGLFEKAQLKKDRQQRIKDANFMKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.4
4 0.38
5 0.34
6 0.36
7 0.33
8 0.36
9 0.36
10 0.34
11 0.36
12 0.36
13 0.34
14 0.3
15 0.25
16 0.21
17 0.19
18 0.19
19 0.14
20 0.12
21 0.1
22 0.09
23 0.08
24 0.05
25 0.05
26 0.06
27 0.08
28 0.09
29 0.1
30 0.09
31 0.13
32 0.16
33 0.18
34 0.2
35 0.19
36 0.18
37 0.19
38 0.19
39 0.15
40 0.11
41 0.11
42 0.09
43 0.08
44 0.09
45 0.08
46 0.08
47 0.08
48 0.09
49 0.09
50 0.09
51 0.09
52 0.08
53 0.09
54 0.09
55 0.1
56 0.1
57 0.08
58 0.09
59 0.1
60 0.1
61 0.09
62 0.1
63 0.1
64 0.1
65 0.11
66 0.1
67 0.1
68 0.14
69 0.22
70 0.26
71 0.3
72 0.3
73 0.31
74 0.36
75 0.36
76 0.32
77 0.27
78 0.28
79 0.23
80 0.23
81 0.22
82 0.18
83 0.17
84 0.16
85 0.15
86 0.17
87 0.2
88 0.26
89 0.33
90 0.37
91 0.44
92 0.54
93 0.63
94 0.64
95 0.71
96 0.75
97 0.79
98 0.8
99 0.82
100 0.78