Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3MJI5

Protein Details
Accession A0A5M3MJI5   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28TYSKRHTKSHTVCRRCGNRAFHRQHKTCHydrophilic
NLS Segment(s)
PositionSequence
46-85KAKRRKTTGTGRMRSLKEVSRRFKNGFRENTVAKKRTRKS
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cput:CONPUDRAFT_59548  -  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences TYSKRHTKSHTVCRRCGNRAFHRQHKTCAQCGYPSAKLRSYEWGQKAKRRKTTGTGRMRSLKEVSRRFKNGFRENTVAKKRTRKSAEASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.76
3 0.74
4 0.73
5 0.72
6 0.76
7 0.78
8 0.78
9 0.8
10 0.77
11 0.75
12 0.74
13 0.69
14 0.63
15 0.58
16 0.5
17 0.41
18 0.41
19 0.4
20 0.37
21 0.36
22 0.34
23 0.33
24 0.33
25 0.32
26 0.35
27 0.33
28 0.35
29 0.35
30 0.41
31 0.41
32 0.46
33 0.55
34 0.56
35 0.62
36 0.59
37 0.57
38 0.57
39 0.65
40 0.69
41 0.7
42 0.66
43 0.63
44 0.65
45 0.63
46 0.58
47 0.51
48 0.47
49 0.46
50 0.51
51 0.53
52 0.54
53 0.59
54 0.59
55 0.62
56 0.66
57 0.66
58 0.64
59 0.64
60 0.61
61 0.6
62 0.66
63 0.69
64 0.64
65 0.62
66 0.65
67 0.64
68 0.68
69 0.71
70 0.68