Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M3N2V9

Protein Details
Accession A0A5M3N2V9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
76-102YSRHHRGYRKGIHKVPKWTRTTNRVNPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
KEGG cput:CONPUDRAFT_48409  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPSLVNQVGLLWKTPWKLSPTRKANARARLKKVDSVIEAVRASGVQCAALNTALLLPKEHEMDPRDKYTVYSRHHRGYRKGIHKVPKWTRTTNRVNPLGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.17
4 0.19
5 0.2
6 0.21
7 0.22
8 0.24
9 0.32
10 0.4
11 0.49
12 0.53
13 0.59
14 0.64
15 0.69
16 0.72
17 0.74
18 0.76
19 0.74
20 0.73
21 0.75
22 0.7
23 0.65
24 0.59
25 0.53
26 0.43
27 0.38
28 0.31
29 0.26
30 0.23
31 0.18
32 0.16
33 0.12
34 0.11
35 0.08
36 0.07
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.05
45 0.06
46 0.07
47 0.07
48 0.07
49 0.09
50 0.11
51 0.11
52 0.14
53 0.16
54 0.21
55 0.24
56 0.26
57 0.26
58 0.24
59 0.26
60 0.3
61 0.35
62 0.35
63 0.41
64 0.44
65 0.51
66 0.58
67 0.62
68 0.62
69 0.64
70 0.69
71 0.69
72 0.73
73 0.72
74 0.76
75 0.77
76 0.8
77 0.8
78 0.79
79 0.76
80 0.76
81 0.77
82 0.77
83 0.81
84 0.79
85 0.79