Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2WCR8

Protein Details
Accession B2WCR8    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
89-109GSSNSKSKKSSKKNGKAPEPEHydrophilic
NLS Segment(s)
PositionSequence
94-106KSKKSSKKNGKAP
Subcellular Location(s) cyto 16, cyto_nucl 10.5, cysk 4, nucl 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019601  Oxoglutarate/Fe-dep_Oase_C  
IPR043044  TPA1/Ofd1_C  
Gene Ontology GO:0016706  F:2-oxoglutarate-dependent dioxygenase activity  
GO:0005506  F:iron ion binding  
GO:0031418  F:L-ascorbic acid binding  
Pfam View protein in Pfam  
PF10637  Ofd1_CTDD  
Amino Acid Sequences MTPYDDLVDILFPHPAFMKWISLVTGITLTKSNIFARRFRRGLDYTLATAYEEEDPQLEVCLGITPSRGWGDEDEEPDEAAASQPEKNGSSNSKSKKSSKKNGKAPEPEPKAEEEIGGYEMYMAGEDDEHPAVPTSSEPSTSTGAGQRRKAKADPAIYKSAGDDEDDGILFSQPAAWNNMAIVLRDRGVLRFTKYVSKSAKGDRWDVCAEYGVEFGEDEDDEDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.15
4 0.16
5 0.18
6 0.16
7 0.18
8 0.18
9 0.18
10 0.17
11 0.14
12 0.16
13 0.13
14 0.13
15 0.14
16 0.13
17 0.14
18 0.17
19 0.2
20 0.24
21 0.28
22 0.34
23 0.4
24 0.48
25 0.48
26 0.47
27 0.51
28 0.47
29 0.48
30 0.47
31 0.43
32 0.35
33 0.34
34 0.32
35 0.24
36 0.21
37 0.18
38 0.14
39 0.11
40 0.09
41 0.09
42 0.09
43 0.09
44 0.09
45 0.08
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.09
54 0.1
55 0.1
56 0.1
57 0.11
58 0.15
59 0.17
60 0.19
61 0.19
62 0.18
63 0.17
64 0.16
65 0.15
66 0.1
67 0.08
68 0.06
69 0.06
70 0.06
71 0.07
72 0.09
73 0.1
74 0.11
75 0.13
76 0.16
77 0.2
78 0.28
79 0.33
80 0.38
81 0.41
82 0.49
83 0.56
84 0.63
85 0.68
86 0.71
87 0.76
88 0.78
89 0.82
90 0.83
91 0.8
92 0.74
93 0.74
94 0.68
95 0.59
96 0.51
97 0.44
98 0.37
99 0.29
100 0.25
101 0.15
102 0.1
103 0.1
104 0.09
105 0.07
106 0.05
107 0.05
108 0.05
109 0.04
110 0.03
111 0.02
112 0.03
113 0.03
114 0.05
115 0.05
116 0.05
117 0.05
118 0.06
119 0.06
120 0.06
121 0.06
122 0.08
123 0.08
124 0.09
125 0.1
126 0.12
127 0.14
128 0.14
129 0.15
130 0.17
131 0.23
132 0.26
133 0.32
134 0.37
135 0.39
136 0.43
137 0.43
138 0.44
139 0.46
140 0.5
141 0.51
142 0.49
143 0.5
144 0.47
145 0.45
146 0.39
147 0.34
148 0.25
149 0.19
150 0.14
151 0.1
152 0.1
153 0.1
154 0.1
155 0.08
156 0.08
157 0.07
158 0.06
159 0.07
160 0.08
161 0.09
162 0.13
163 0.13
164 0.13
165 0.13
166 0.17
167 0.15
168 0.15
169 0.16
170 0.14
171 0.14
172 0.16
173 0.17
174 0.14
175 0.16
176 0.18
177 0.2
178 0.23
179 0.24
180 0.32
181 0.33
182 0.4
183 0.42
184 0.44
185 0.46
186 0.51
187 0.55
188 0.5
189 0.55
190 0.49
191 0.5
192 0.48
193 0.44
194 0.36
195 0.33
196 0.3
197 0.23
198 0.21
199 0.16
200 0.13
201 0.11
202 0.1
203 0.09
204 0.08
205 0.08