Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A061HL85

Protein Details
Accession A0A061HL85    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
85-114RPKQTRAIRRRLSKGDKARKLPKITKREVHBasic
NLS Segment(s)
PositionSequence
85-116RPKQTRAIRRRLSKGDKARKLPKITKREVHFP
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences SNSKVKIGQLWPKNKTDLMKQLGELKTELGQLRTQKIAGGATSKLTKIHDVRKSIAKVLTVINANQRTQLRIFYKHKKYLPLDLRPKQTRAIRRRLSKGDKARKLPKITKREVHFPQRKFVIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.54
3 0.52
4 0.52
5 0.48
6 0.45
7 0.43
8 0.48
9 0.45
10 0.43
11 0.35
12 0.27
13 0.23
14 0.24
15 0.24
16 0.17
17 0.19
18 0.21
19 0.23
20 0.23
21 0.21
22 0.19
23 0.19
24 0.18
25 0.15
26 0.14
27 0.12
28 0.13
29 0.14
30 0.14
31 0.14
32 0.14
33 0.18
34 0.2
35 0.28
36 0.32
37 0.34
38 0.36
39 0.42
40 0.42
41 0.4
42 0.37
43 0.29
44 0.25
45 0.22
46 0.22
47 0.16
48 0.15
49 0.18
50 0.19
51 0.18
52 0.21
53 0.2
54 0.19
55 0.19
56 0.25
57 0.22
58 0.28
59 0.35
60 0.41
61 0.49
62 0.55
63 0.57
64 0.59
65 0.59
66 0.61
67 0.63
68 0.63
69 0.65
70 0.64
71 0.7
72 0.66
73 0.65
74 0.62
75 0.61
76 0.61
77 0.6
78 0.64
79 0.63
80 0.68
81 0.74
82 0.77
83 0.79
84 0.79
85 0.81
86 0.81
87 0.81
88 0.82
89 0.83
90 0.82
91 0.83
92 0.82
93 0.81
94 0.8
95 0.81
96 0.8
97 0.76
98 0.78
99 0.77
100 0.79
101 0.78
102 0.71
103 0.71