Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061HH39

Protein Details
Accession A0A061HH39    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
103-129SGADRETKARKRQKKAIKKVTEEEKKGBasic
NLS Segment(s)
PositionSequence
109-122TKARKRQKKAIKKV
Subcellular Location(s) cyto 14, cyto_nucl 12, nucl 8, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MSAISGLVKQGGDNLVRNVWGMWDGMRLRDYIRIVVIVGVYLLLRPYLLKFAAKIQAKQHAKIPDTDSSTSSVKISPNQLRSTGMVVSEHDDLGDAEKDQIASGADRETKARKRQKKAIKKVTEEEKKGLEAQGENDDKEIMDLLIDYEEGKDGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.2
5 0.17
6 0.14
7 0.13
8 0.11
9 0.09
10 0.14
11 0.14
12 0.16
13 0.16
14 0.16
15 0.16
16 0.21
17 0.21
18 0.17
19 0.17
20 0.15
21 0.15
22 0.15
23 0.14
24 0.09
25 0.07
26 0.06
27 0.05
28 0.04
29 0.04
30 0.03
31 0.04
32 0.04
33 0.05
34 0.07
35 0.08
36 0.09
37 0.1
38 0.14
39 0.21
40 0.23
41 0.26
42 0.26
43 0.35
44 0.37
45 0.38
46 0.4
47 0.38
48 0.37
49 0.37
50 0.38
51 0.33
52 0.34
53 0.34
54 0.29
55 0.26
56 0.26
57 0.23
58 0.2
59 0.16
60 0.13
61 0.15
62 0.2
63 0.22
64 0.26
65 0.26
66 0.27
67 0.26
68 0.26
69 0.26
70 0.19
71 0.15
72 0.11
73 0.1
74 0.12
75 0.11
76 0.1
77 0.08
78 0.08
79 0.07
80 0.08
81 0.09
82 0.06
83 0.06
84 0.07
85 0.07
86 0.06
87 0.07
88 0.06
89 0.06
90 0.06
91 0.08
92 0.1
93 0.1
94 0.13
95 0.2
96 0.27
97 0.36
98 0.46
99 0.53
100 0.61
101 0.71
102 0.79
103 0.83
104 0.87
105 0.89
106 0.88
107 0.85
108 0.84
109 0.85
110 0.83
111 0.76
112 0.69
113 0.6
114 0.53
115 0.47
116 0.41
117 0.33
118 0.24
119 0.23
120 0.28
121 0.28
122 0.26
123 0.25
124 0.24
125 0.21
126 0.2
127 0.18
128 0.09
129 0.06
130 0.06
131 0.06
132 0.07
133 0.07
134 0.07
135 0.06