Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A656KKT6

Protein Details
Accession A0A656KKT6    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
76-102KAMSARRREYRDRKVREKRERAEQERIBasic
NLS Segment(s)
PositionSequence
65-101KRRRDAERELEKAMSARRREYRDRKVREKRERAEQER
116-137EKAAKEEKRKAEFAELKAIRER
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027512  EIF3A  
Gene Ontology GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0003743  F:translation initiation factor activity  
Amino Acid Sequences MPLDYEQQRQRDIDAHNKAKVQTLRDAEIKHKENLQLKHRLSRLVPQYENYRISIIERRHDEFEKRRRDAERELEKAMSARRREYRDRKVREKRERAEQERILREEEENAAKELEEKAAKEEKRKAEFAELKAIRERERKESLEIAALQQRRAEEAEQRRAQAKAAGTSLSKESDANKPARWQPRREMQESLPPRSGSTAVRPSFASGRLDDTDKGRPPQLPLVGLRPSGTSWRDKDLTAVSTSQNPPRTVQRENSPTRERPSTIASSESLKPTGGAGKFIPPHLRKKLAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.52
4 0.55
5 0.53
6 0.55
7 0.54
8 0.48
9 0.45
10 0.44
11 0.44
12 0.46
13 0.47
14 0.46
15 0.51
16 0.5
17 0.45
18 0.45
19 0.47
20 0.5
21 0.55
22 0.57
23 0.57
24 0.57
25 0.63
26 0.6
27 0.58
28 0.52
29 0.53
30 0.55
31 0.53
32 0.51
33 0.47
34 0.51
35 0.52
36 0.52
37 0.44
38 0.36
39 0.28
40 0.3
41 0.33
42 0.31
43 0.32
44 0.34
45 0.36
46 0.4
47 0.44
48 0.48
49 0.51
50 0.57
51 0.59
52 0.58
53 0.61
54 0.6
55 0.62
56 0.63
57 0.63
58 0.63
59 0.57
60 0.56
61 0.5
62 0.46
63 0.43
64 0.4
65 0.37
66 0.29
67 0.32
68 0.37
69 0.43
70 0.53
71 0.6
72 0.66
73 0.69
74 0.76
75 0.8
76 0.84
77 0.88
78 0.89
79 0.9
80 0.84
81 0.84
82 0.86
83 0.81
84 0.8
85 0.75
86 0.72
87 0.68
88 0.64
89 0.55
90 0.45
91 0.39
92 0.32
93 0.28
94 0.23
95 0.17
96 0.16
97 0.14
98 0.13
99 0.14
100 0.13
101 0.13
102 0.11
103 0.1
104 0.14
105 0.21
106 0.22
107 0.27
108 0.33
109 0.38
110 0.41
111 0.42
112 0.4
113 0.42
114 0.46
115 0.42
116 0.45
117 0.39
118 0.36
119 0.38
120 0.38
121 0.32
122 0.33
123 0.34
124 0.3
125 0.35
126 0.35
127 0.34
128 0.35
129 0.32
130 0.28
131 0.26
132 0.21
133 0.21
134 0.2
135 0.17
136 0.16
137 0.15
138 0.14
139 0.15
140 0.14
141 0.17
142 0.23
143 0.32
144 0.32
145 0.34
146 0.34
147 0.33
148 0.33
149 0.29
150 0.23
151 0.16
152 0.15
153 0.16
154 0.14
155 0.15
156 0.16
157 0.13
158 0.12
159 0.11
160 0.12
161 0.17
162 0.21
163 0.23
164 0.23
165 0.27
166 0.33
167 0.43
168 0.46
169 0.45
170 0.48
171 0.55
172 0.6
173 0.59
174 0.56
175 0.48
176 0.53
177 0.53
178 0.51
179 0.45
180 0.39
181 0.36
182 0.33
183 0.33
184 0.24
185 0.26
186 0.3
187 0.27
188 0.28
189 0.28
190 0.29
191 0.29
192 0.3
193 0.25
194 0.17
195 0.2
196 0.21
197 0.23
198 0.22
199 0.23
200 0.27
201 0.29
202 0.3
203 0.29
204 0.29
205 0.31
206 0.36
207 0.35
208 0.31
209 0.3
210 0.32
211 0.32
212 0.31
213 0.28
214 0.22
215 0.21
216 0.23
217 0.24
218 0.25
219 0.25
220 0.31
221 0.32
222 0.31
223 0.33
224 0.31
225 0.31
226 0.27
227 0.27
228 0.22
229 0.27
230 0.31
231 0.34
232 0.36
233 0.35
234 0.36
235 0.44
236 0.47
237 0.46
238 0.48
239 0.52
240 0.56
241 0.61
242 0.67
243 0.66
244 0.66
245 0.67
246 0.66
247 0.59
248 0.52
249 0.52
250 0.48
251 0.42
252 0.39
253 0.34
254 0.33
255 0.35
256 0.35
257 0.29
258 0.23
259 0.22
260 0.21
261 0.27
262 0.23
263 0.22
264 0.2
265 0.27
266 0.3
267 0.33
268 0.42
269 0.39
270 0.48
271 0.54