Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061HN20

Protein Details
Accession A0A061HN20    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
67-87ASNIRKKWMQRADRERRSQAEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013846  mRNA_cap_enzyme_C  
IPR012340  NA-bd_OB-fold  
Pfam View protein in Pfam  
PF03919  mRNA_cap_C  
Amino Acid Sequences MDEWEAFKAETKPVNNRIVECFMDEKQRWRYKRFRDDKINANYTSTVDSVIESITDRVTGEDLEKAASNIRKKWMQRADRERRSQAENTISRPMRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.47
3 0.47
4 0.47
5 0.45
6 0.41
7 0.36
8 0.32
9 0.26
10 0.33
11 0.32
12 0.34
13 0.39
14 0.47
15 0.48
16 0.52
17 0.6
18 0.62
19 0.72
20 0.74
21 0.73
22 0.76
23 0.77
24 0.8
25 0.78
26 0.73
27 0.62
28 0.55
29 0.46
30 0.36
31 0.32
32 0.22
33 0.15
34 0.09
35 0.09
36 0.07
37 0.07
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.08
51 0.08
52 0.08
53 0.12
54 0.17
55 0.2
56 0.22
57 0.27
58 0.33
59 0.35
60 0.45
61 0.51
62 0.54
63 0.62
64 0.7
65 0.75
66 0.79
67 0.85
68 0.81
69 0.75
70 0.73
71 0.67
72 0.62
73 0.61
74 0.56
75 0.52
76 0.56