Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7TPE8

Protein Details
Accession A7TPE8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-71QTEAAKKDAAKKTKKGKKRNBasic
NLS Segment(s)
PositionSequence
55-71AAKKDAAKKTKKGKKRN
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG vpo:Kpol_1009p23  -  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
Amino Acid Sequences MRPRKYATISKTHKTVSRIYGGSRCSNCVKERITRAFLIEEQKIVKKVVKEQTEAAKKDAAKKTKKGKKRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.52
3 0.46
4 0.45
5 0.41
6 0.4
7 0.4
8 0.39
9 0.42
10 0.37
11 0.36
12 0.32
13 0.35
14 0.33
15 0.34
16 0.33
17 0.32
18 0.38
19 0.4
20 0.39
21 0.36
22 0.35
23 0.31
24 0.31
25 0.29
26 0.22
27 0.18
28 0.17
29 0.18
30 0.19
31 0.18
32 0.18
33 0.17
34 0.24
35 0.31
36 0.34
37 0.34
38 0.37
39 0.46
40 0.52
41 0.52
42 0.46
43 0.42
44 0.4
45 0.47
46 0.52
47 0.51
48 0.51
49 0.58
50 0.67
51 0.73