Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A061HJQ5

Protein Details
Accession A0A061HJQ5    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAPTTQTPPPRDKKRRIAVMTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035966  PKF_sf  
Gene Ontology GO:0003872  F:6-phosphofructokinase activity  
Amino Acid Sequences MAPTTQTPPPRDKKRRIAVMTSGGDSPGMNAARCEPSLDSPSRKAVKPIVCTKDTKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.82
4 0.77
5 0.71
6 0.69
7 0.61
8 0.52
9 0.42
10 0.32
11 0.27
12 0.21
13 0.16
14 0.11
15 0.1
16 0.08
17 0.08
18 0.1
19 0.12
20 0.12
21 0.13
22 0.11
23 0.14
24 0.18
25 0.22
26 0.24
27 0.25
28 0.33
29 0.36
30 0.36
31 0.36
32 0.4
33 0.43
34 0.48
35 0.55
36 0.54
37 0.54