Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2VWF6

Protein Details
Accession B2VWF6    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
154-194EAERARKKLNNNTKKPIRQSQNGKRKASKVNNNRNKGQKRVHydrophilic
NLS Segment(s)
PositionSequence
134-192EKRAAREAAKEVRMKEKAEKEAERARKKLNNNTKKPIRQSQNGKRKASKVNNNRNKGQK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
Amino Acid Sequences MTPELIKKAFTATGICPPDPTPVLKKFKPATPEVSSSDEDSTSPLSELLRNEIKGLTEELCRRGERQKSYPLKRREHLDTPHGGAVFWSPRKLRQAREQWAEKQQKRDQEKLQKTRISELREQARLYKLKVTQEKRAAREAAKEVRMKEKAEKEAERARKKLNNNTKKPIRQSQNGKRKASKVNNNRNKGQKRVVDSVVDEGEASGAAPASPPRVTRHGRNIKLPAKYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.3
4 0.29
5 0.33
6 0.32
7 0.33
8 0.32
9 0.36
10 0.45
11 0.45
12 0.52
13 0.52
14 0.55
15 0.56
16 0.53
17 0.52
18 0.49
19 0.52
20 0.47
21 0.47
22 0.44
23 0.4
24 0.37
25 0.29
26 0.23
27 0.2
28 0.18
29 0.14
30 0.13
31 0.11
32 0.11
33 0.13
34 0.14
35 0.19
36 0.21
37 0.2
38 0.21
39 0.21
40 0.21
41 0.19
42 0.2
43 0.16
44 0.17
45 0.19
46 0.22
47 0.24
48 0.24
49 0.26
50 0.31
51 0.37
52 0.39
53 0.43
54 0.5
55 0.57
56 0.66
57 0.73
58 0.75
59 0.75
60 0.71
61 0.72
62 0.69
63 0.66
64 0.61
65 0.58
66 0.52
67 0.47
68 0.46
69 0.39
70 0.32
71 0.24
72 0.21
73 0.2
74 0.18
75 0.18
76 0.16
77 0.2
78 0.29
79 0.32
80 0.34
81 0.39
82 0.48
83 0.53
84 0.6
85 0.61
86 0.57
87 0.64
88 0.69
89 0.62
90 0.61
91 0.56
92 0.57
93 0.58
94 0.6
95 0.58
96 0.59
97 0.66
98 0.65
99 0.69
100 0.63
101 0.59
102 0.59
103 0.56
104 0.5
105 0.45
106 0.42
107 0.41
108 0.41
109 0.4
110 0.36
111 0.37
112 0.33
113 0.3
114 0.3
115 0.27
116 0.32
117 0.4
118 0.41
119 0.44
120 0.51
121 0.56
122 0.54
123 0.56
124 0.51
125 0.44
126 0.45
127 0.42
128 0.39
129 0.38
130 0.38
131 0.35
132 0.4
133 0.42
134 0.39
135 0.4
136 0.41
137 0.42
138 0.45
139 0.46
140 0.44
141 0.5
142 0.58
143 0.57
144 0.54
145 0.54
146 0.54
147 0.59
148 0.64
149 0.67
150 0.68
151 0.69
152 0.76
153 0.79
154 0.8
155 0.81
156 0.8
157 0.77
158 0.75
159 0.78
160 0.79
161 0.8
162 0.81
163 0.8
164 0.76
165 0.75
166 0.77
167 0.76
168 0.76
169 0.76
170 0.79
171 0.82
172 0.83
173 0.84
174 0.84
175 0.8
176 0.77
177 0.75
178 0.7
179 0.67
180 0.67
181 0.62
182 0.55
183 0.49
184 0.46
185 0.38
186 0.31
187 0.24
188 0.17
189 0.14
190 0.11
191 0.09
192 0.05
193 0.04
194 0.04
195 0.05
196 0.06
197 0.1
198 0.12
199 0.14
200 0.19
201 0.27
202 0.33
203 0.41
204 0.51
205 0.59
206 0.63
207 0.7
208 0.75
209 0.73