Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A061HLH3

Protein Details
Accession A0A061HLH3    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28APANTGAKKQKKKWSKGKVKDKAQHVVIHydrophilic
NLS Segment(s)
PositionSequence
7-21AKKQKKKWSKGKVKD
Subcellular Location(s) mito_nucl 10, nucl 9.5, mito 9.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences APANTGAKKQKKKWSKGKVKDKAQHVVILDKATSDKLYKDVQSYRLVTVATLVDRLKINGSLARRCLKDLEEKGQIKKVVGHSKLQIYSMHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.9
4 0.93
5 0.92
6 0.93
7 0.9
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.48
14 0.39
15 0.32
16 0.25
17 0.18
18 0.16
19 0.13
20 0.13
21 0.1
22 0.09
23 0.11
24 0.14
25 0.15
26 0.18
27 0.2
28 0.23
29 0.26
30 0.27
31 0.24
32 0.23
33 0.22
34 0.17
35 0.16
36 0.13
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.1
43 0.1
44 0.1
45 0.11
46 0.12
47 0.16
48 0.18
49 0.22
50 0.27
51 0.27
52 0.28
53 0.29
54 0.28
55 0.34
56 0.36
57 0.38
58 0.42
59 0.45
60 0.47
61 0.51
62 0.5
63 0.41
64 0.42
65 0.44
66 0.45
67 0.44
68 0.45
69 0.44
70 0.5
71 0.51
72 0.47