Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061HHZ9

Protein Details
Accession A0A061HHZ9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MVSAKKHIPIVKKRTKRFHRHQSDTYKCVHydrophilic
NLS Segment(s)
PositionSequence
12-17KKRTKR
Subcellular Location(s) mito 23.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHIPIVKKRTKRFHRHQSDTYKCVDPSWRKPKGIDNRVRRRFAGQIAMPSIGYGSNKKTRHMMPSGHKAFLVHNTRDIDLLLMHNKTFAAEISHSVSSRKRIAIIQRAKELSVKVTNSKARITTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.88
3 0.9
4 0.9
5 0.91
6 0.91
7 0.9
8 0.9
9 0.9
10 0.87
11 0.79
12 0.73
13 0.66
14 0.55
15 0.48
16 0.48
17 0.45
18 0.48
19 0.55
20 0.57
21 0.54
22 0.56
23 0.64
24 0.66
25 0.68
26 0.67
27 0.68
28 0.72
29 0.79
30 0.79
31 0.71
32 0.63
33 0.57
34 0.5
35 0.46
36 0.36
37 0.31
38 0.3
39 0.29
40 0.25
41 0.21
42 0.18
43 0.11
44 0.11
45 0.09
46 0.11
47 0.19
48 0.2
49 0.21
50 0.25
51 0.26
52 0.31
53 0.33
54 0.35
55 0.34
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.32
62 0.34
63 0.33
64 0.24
65 0.26
66 0.27
67 0.27
68 0.27
69 0.25
70 0.17
71 0.12
72 0.14
73 0.12
74 0.11
75 0.11
76 0.11
77 0.11
78 0.1
79 0.1
80 0.09
81 0.09
82 0.09
83 0.11
84 0.15
85 0.17
86 0.17
87 0.19
88 0.21
89 0.23
90 0.26
91 0.25
92 0.23
93 0.27
94 0.35
95 0.44
96 0.5
97 0.51
98 0.55
99 0.55
100 0.54
101 0.52
102 0.45
103 0.4
104 0.38
105 0.35
106 0.32
107 0.38
108 0.43
109 0.43
110 0.45
111 0.43