Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A061HPT9

Protein Details
Accession A0A061HPT9    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MERKNNNARKKKKNEDVARLRKLVHydrophilic
NLS Segment(s)
PositionSequence
7-16NARKKKKNED
33-107RIKKFRQAASANKNKKRLEKEAVEKSEKEAAAAAKAKKEAEAKEAEDKAKAERELGKKAKETAKAAVKKNRRVLK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR032003  RAC_head  
IPR042569  RAC_head_sf  
IPR044634  Zuotin/DnaJC2  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0015934  C:large ribosomal subunit  
GO:0005730  C:nucleolus  
GO:0042788  C:polysomal ribosome  
GO:0015935  C:small ribosomal subunit  
GO:0030544  F:Hsp70 protein binding  
GO:0043022  F:ribosome binding  
GO:0051083  P:'de novo' cotranslational protein folding  
GO:0071409  P:cellular response to cycloheximide  
GO:0060548  P:negative regulation of cell death  
GO:0036003  P:positive regulation of transcription from RNA polymerase II promoter in response to stress  
GO:0006450  P:regulation of translational fidelity  
GO:0000054  P:ribosomal subunit export from nucleus  
GO:0006364  P:rRNA processing  
GO:0006452  P:translational frameshifting  
Pfam View protein in Pfam  
PF16717  RAC_head  
Amino Acid Sequences MERKNNNARKKKKNEDVARLRKLVDDAMAGDERIKKFRQAASANKNKKRLEKEAVEKSEKEAAAAAKAKKEAEAKEAEDKAKAERELGKKAKETAKAAVKKNRRVLKGSVKDANYFVDETASASRIDQVLGDVELVQGKLSPDETAALAAKLAGLKVSQEIKGVWSEEVKRLIDSQSIKEGDAATLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.92
4 0.91
5 0.88
6 0.79
7 0.7
8 0.61
9 0.52
10 0.42
11 0.32
12 0.23
13 0.17
14 0.19
15 0.18
16 0.16
17 0.17
18 0.21
19 0.21
20 0.24
21 0.24
22 0.23
23 0.28
24 0.31
25 0.38
26 0.4
27 0.48
28 0.55
29 0.64
30 0.71
31 0.72
32 0.77
33 0.72
34 0.74
35 0.71
36 0.69
37 0.67
38 0.65
39 0.68
40 0.7
41 0.72
42 0.67
43 0.6
44 0.55
45 0.52
46 0.43
47 0.34
48 0.26
49 0.2
50 0.2
51 0.25
52 0.23
53 0.2
54 0.21
55 0.21
56 0.22
57 0.26
58 0.22
59 0.21
60 0.23
61 0.24
62 0.29
63 0.31
64 0.28
65 0.26
66 0.25
67 0.23
68 0.23
69 0.21
70 0.16
71 0.21
72 0.24
73 0.32
74 0.35
75 0.36
76 0.34
77 0.38
78 0.41
79 0.38
80 0.36
81 0.34
82 0.38
83 0.42
84 0.46
85 0.5
86 0.53
87 0.56
88 0.62
89 0.63
90 0.57
91 0.54
92 0.56
93 0.58
94 0.58
95 0.57
96 0.54
97 0.49
98 0.47
99 0.44
100 0.39
101 0.29
102 0.22
103 0.16
104 0.11
105 0.1
106 0.1
107 0.1
108 0.09
109 0.08
110 0.08
111 0.09
112 0.09
113 0.09
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.06
120 0.06
121 0.07
122 0.07
123 0.06
124 0.06
125 0.06
126 0.07
127 0.07
128 0.07
129 0.07
130 0.08
131 0.08
132 0.09
133 0.1
134 0.09
135 0.08
136 0.08
137 0.08
138 0.07
139 0.07
140 0.06
141 0.05
142 0.06
143 0.1
144 0.13
145 0.13
146 0.14
147 0.15
148 0.16
149 0.19
150 0.19
151 0.17
152 0.19
153 0.21
154 0.25
155 0.3
156 0.29
157 0.27
158 0.28
159 0.28
160 0.3
161 0.3
162 0.29
163 0.32
164 0.33
165 0.32
166 0.32
167 0.31