Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A061HLC0

Protein Details
Accession A0A061HLC0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-60SSPAEKQESKQKKRKLFETRATDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 6, mito 3
Family & Domain DBs
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0005737  C:cytoplasm  
GO:0030332  F:cyclin binding  
GO:1990757  F:ubiquitin ligase activator activity  
GO:1902426  P:deactivation of mitotic spindle assembly checkpoint  
GO:0010697  P:negative regulation of mitotic spindle pole body separation  
GO:1905786  P:positive regulation of anaphase-promoting complex-dependent catabolic process  
GO:0120151  P:positive regulation of mitotic actomyosin contractile ring disassembly  
Amino Acid Sequences MGTSVDIFLSAKITENKINASTQGDPPSADAPVSKPFSSPAEKQESKQKKRKLFETRATD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.23
4 0.23
5 0.23
6 0.21
7 0.22
8 0.21
9 0.21
10 0.23
11 0.21
12 0.19
13 0.2
14 0.19
15 0.16
16 0.13
17 0.1
18 0.09
19 0.14
20 0.17
21 0.15
22 0.15
23 0.17
24 0.2
25 0.25
26 0.26
27 0.26
28 0.33
29 0.35
30 0.37
31 0.46
32 0.53
33 0.58
34 0.65
35 0.68
36 0.68
37 0.75
38 0.84
39 0.84
40 0.83