Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061HRP8

Protein Details
Accession A0A061HRP8   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-55SEDISNVNPRKRRRKERNPKESSALHydrophilic
65-84TEPSKRWKNKMNLRRKGVNFHydrophilic
NLS Segment(s)
PositionSequence
39-50PRKRRRKERNPK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022159  STIP/TFIP11_N  
Pfam View protein in Pfam  
PF12457  TIP_N  
Amino Acid Sequences MYSAQNNARYSSTESSGEDEDFLYPLTNVNSEDISNVNPRKRRRKERNPKESSALGIFGSDSEDTEPSKRWKNKMNLRRKGVNFVQTTNINDADEQRDHEDSDINATDIEKRHASLSLGPGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.29
4 0.26
5 0.21
6 0.18
7 0.15
8 0.13
9 0.12
10 0.09
11 0.07
12 0.08
13 0.09
14 0.09
15 0.09
16 0.1
17 0.11
18 0.1
19 0.11
20 0.1
21 0.12
22 0.17
23 0.21
24 0.25
25 0.31
26 0.39
27 0.5
28 0.59
29 0.69
30 0.73
31 0.8
32 0.87
33 0.92
34 0.95
35 0.91
36 0.85
37 0.78
38 0.68
39 0.59
40 0.48
41 0.37
42 0.26
43 0.18
44 0.14
45 0.09
46 0.09
47 0.06
48 0.06
49 0.05
50 0.06
51 0.07
52 0.08
53 0.11
54 0.13
55 0.22
56 0.26
57 0.3
58 0.38
59 0.48
60 0.57
61 0.65
62 0.72
63 0.73
64 0.75
65 0.8
66 0.73
67 0.71
68 0.65
69 0.63
70 0.54
71 0.46
72 0.44
73 0.38
74 0.38
75 0.33
76 0.29
77 0.21
78 0.19
79 0.2
80 0.2
81 0.18
82 0.19
83 0.19
84 0.19
85 0.2
86 0.2
87 0.2
88 0.16
89 0.2
90 0.18
91 0.15
92 0.15
93 0.15
94 0.18
95 0.18
96 0.22
97 0.18
98 0.18
99 0.19
100 0.21
101 0.23
102 0.24