Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2VYM6

Protein Details
Accession B2VYM6    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-74SPNSHRSYVNTKKKTKRVLWDFEKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 10, nucl 2
Family & Domain DBs
Amino Acid Sequences MFITLYAPKAQPIPQIVADIVEGLGRLGWVISWGWEMPAAASSQPANYLRSPNSHRSYVNTKKKTKRVLWDFEKLSLWLCW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.24
4 0.22
5 0.2
6 0.16
7 0.12
8 0.08
9 0.07
10 0.05
11 0.05
12 0.04
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.04
19 0.05
20 0.05
21 0.05
22 0.06
23 0.06
24 0.05
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.05
31 0.08
32 0.09
33 0.11
34 0.12
35 0.15
36 0.16
37 0.22
38 0.27
39 0.33
40 0.36
41 0.37
42 0.37
43 0.39
44 0.48
45 0.53
46 0.59
47 0.59
48 0.65
49 0.71
50 0.79
51 0.83
52 0.81
53 0.81
54 0.8
55 0.81
56 0.79
57 0.79
58 0.73
59 0.67
60 0.61
61 0.5