Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061HIE2

Protein Details
Accession A0A061HIE2   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-33ISTQRRSSNRGRGGRRIRRSTHydrophilic
NLS Segment(s)
PositionSequence
21-32NRGRGGRRIRRS
Subcellular Location(s) nucl 14, cyto_nucl 13, cyto 8, mito 5
Family & Domain DBs
Amino Acid Sequences MSGKIDQSLDEIISTQRRSSNRGRGGRRIRRSTHVGRATPVTPSGGVKKMTKTVKHTVKTVPIGPSGTPSNGKIIVTGLPRDVNEGMIKVCYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.23
4 0.24
5 0.3
6 0.38
7 0.45
8 0.49
9 0.57
10 0.61
11 0.66
12 0.76
13 0.8
14 0.81
15 0.79
16 0.73
17 0.7
18 0.72
19 0.68
20 0.67
21 0.64
22 0.56
23 0.49
24 0.48
25 0.42
26 0.35
27 0.29
28 0.2
29 0.13
30 0.13
31 0.14
32 0.14
33 0.16
34 0.16
35 0.17
36 0.23
37 0.27
38 0.3
39 0.33
40 0.4
41 0.47
42 0.48
43 0.49
44 0.46
45 0.48
46 0.48
47 0.45
48 0.38
49 0.31
50 0.3
51 0.27
52 0.27
53 0.22
54 0.21
55 0.19
56 0.18
57 0.19
58 0.19
59 0.19
60 0.16
61 0.16
62 0.18
63 0.19
64 0.19
65 0.18
66 0.19
67 0.19
68 0.22
69 0.21
70 0.19
71 0.18
72 0.18
73 0.17