Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F6L3

Protein Details
Accession A7F6L3   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-26PWLSCVTAKGRRKRKFEQQSFKEDAHydrophilic
NLS Segment(s)
PositionSequence
13-14RK
Subcellular Location(s) nucl 12.5, mito 9, cyto_nucl 9, cyto 4.5
Family & Domain DBs
KEGG ssl:SS1G_13242  -  
Amino Acid Sequences MPWLSCVTAKGRRKRKFEQQSFKEDAGITASDTGDGQLILRTEFFRRLFLIRYSTVISEFQTSSRRVWERQGFDTQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.83
4 0.85
5 0.86
6 0.82
7 0.82
8 0.79
9 0.71
10 0.62
11 0.5
12 0.39
13 0.3
14 0.24
15 0.15
16 0.11
17 0.1
18 0.08
19 0.08
20 0.07
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.06
28 0.07
29 0.08
30 0.13
31 0.13
32 0.14
33 0.15
34 0.17
35 0.19
36 0.2
37 0.23
38 0.19
39 0.21
40 0.21
41 0.2
42 0.2
43 0.18
44 0.17
45 0.16
46 0.16
47 0.16
48 0.19
49 0.21
50 0.2
51 0.28
52 0.31
53 0.3
54 0.39
55 0.46
56 0.47
57 0.51