Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EAR4

Protein Details
Accession A7EAR4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAWPPSHQYHKKLRRREYAAHPFIFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 6, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ssl:SS1G_02396  -  
Amino Acid Sequences MAWPPSHQYHKKLRRREYAAHPFIFTIFTMFSYRVRSAVLDAKIYHSHSATVLEDNLRITYFGAAAVLSPVRRAVYIKVDGRINSRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.83
4 0.83
5 0.83
6 0.81
7 0.72
8 0.63
9 0.52
10 0.45
11 0.38
12 0.27
13 0.17
14 0.1
15 0.09
16 0.1
17 0.11
18 0.11
19 0.15
20 0.15
21 0.14
22 0.14
23 0.13
24 0.14
25 0.2
26 0.19
27 0.17
28 0.17
29 0.19
30 0.2
31 0.21
32 0.19
33 0.13
34 0.13
35 0.11
36 0.13
37 0.11
38 0.1
39 0.1
40 0.1
41 0.1
42 0.1
43 0.1
44 0.08
45 0.08
46 0.07
47 0.07
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.06
54 0.07
55 0.07
56 0.07
57 0.08
58 0.09
59 0.1
60 0.12
61 0.14
62 0.2
63 0.28
64 0.31
65 0.35
66 0.38
67 0.4