Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7F8L9

Protein Details
Accession A7F8L9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-50SDYEKKDKKFDFKKKSLPDGESBasic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
KEGG ssl:SS1G_13950  -  
Amino Acid Sequences MGKENRREGKRGLSSIDRISDTAGASMGSDYEKKDKKFDFKKKSLPDGESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.44
4 0.35
5 0.28
6 0.26
7 0.22
8 0.17
9 0.13
10 0.1
11 0.07
12 0.06
13 0.06
14 0.05
15 0.05
16 0.06
17 0.07
18 0.15
19 0.2
20 0.21
21 0.28
22 0.33
23 0.42
24 0.53
25 0.62
26 0.65
27 0.69
28 0.78
29 0.8
30 0.85
31 0.82