Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7ENZ1

Protein Details
Accession A7ENZ1    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MASKSNPNVPQKKRKIANRAKTQRKNAINKITKNHydrophilic
NLS Segment(s)
PositionSequence
11-36QKKRKIANRAKTQRKNAINKITKNPR
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
KEGG ssl:SS1G_07040  -  
Amino Acid Sequences MASKSNPNVPQKKRKIANRAKTQRKNAINKITKNPRGTRASTVLFPTSGPLAPVSGKKARKLQKAQNCARQRALKQAMKEGEVKMTDAPETSETAANAENQGMEVDNIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.86
4 0.87
5 0.88
6 0.89
7 0.9
8 0.9
9 0.9
10 0.88
11 0.87
12 0.86
13 0.83
14 0.83
15 0.81
16 0.77
17 0.78
18 0.79
19 0.76
20 0.74
21 0.69
22 0.66
23 0.63
24 0.6
25 0.55
26 0.49
27 0.45
28 0.39
29 0.37
30 0.3
31 0.24
32 0.21
33 0.17
34 0.13
35 0.11
36 0.09
37 0.07
38 0.07
39 0.08
40 0.09
41 0.12
42 0.18
43 0.19
44 0.22
45 0.3
46 0.37
47 0.45
48 0.52
49 0.57
50 0.61
51 0.69
52 0.73
53 0.75
54 0.74
55 0.68
56 0.67
57 0.64
58 0.56
59 0.56
60 0.58
61 0.52
62 0.47
63 0.51
64 0.47
65 0.43
66 0.44
67 0.35
68 0.3
69 0.27
70 0.26
71 0.19
72 0.18
73 0.16
74 0.14
75 0.15
76 0.12
77 0.13
78 0.14
79 0.15
80 0.14
81 0.15
82 0.16
83 0.15
84 0.14
85 0.13
86 0.11
87 0.09
88 0.1
89 0.09