Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7F2K7

Protein Details
Accession A7F2K7    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-40DVSEISRRREKRKVRDYSAKKHGIQBasic
NLS Segment(s)
PositionSequence
22-30RRREKRKVR
Subcellular Location(s) nucl 19, cyto_nucl 15.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR034904  FSCA_dom_sf  
IPR039796  MIP18  
IPR002744  MIP18-like  
Gene Ontology GO:0097361  C:CIA complex  
GO:0016226  P:iron-sulfur cluster assembly  
GO:0106035  P:protein maturation by [4Fe-4S] cluster transfer  
KEGG ssl:SS1G_12155  -  
Pfam View protein in Pfam  
PF01883  FeS_assembly_P  
Amino Acid Sequences MESKDDIQNANPTILDVSEISRRREKRKVRDYSAKKHGIQSILMAKPSYALDPFYLSDLSEDSDDSGLEPIDEQEIYDLIAPISDPEHPLSLESLGVVKLEDVHLTSPSDLTNPAALSRVLVELTPTVSHCSLATVIGLGVRVRLEQALPPSYRVEVKIKKDTHSQAAEVNKQLADKERVAAALENDNLMNLLRKMMKTCLDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.11
4 0.12
5 0.19
6 0.23
7 0.27
8 0.35
9 0.41
10 0.47
11 0.57
12 0.64
13 0.67
14 0.74
15 0.8
16 0.81
17 0.86
18 0.88
19 0.88
20 0.88
21 0.84
22 0.76
23 0.71
24 0.67
25 0.58
26 0.49
27 0.44
28 0.42
29 0.36
30 0.34
31 0.29
32 0.24
33 0.23
34 0.23
35 0.19
36 0.12
37 0.11
38 0.1
39 0.12
40 0.13
41 0.13
42 0.13
43 0.11
44 0.11
45 0.1
46 0.1
47 0.08
48 0.08
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.06
55 0.05
56 0.05
57 0.05
58 0.06
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.06
73 0.06
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.07
80 0.06
81 0.06
82 0.05
83 0.05
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.08
103 0.08
104 0.07
105 0.08
106 0.07
107 0.06
108 0.06
109 0.06
110 0.06
111 0.07
112 0.07
113 0.07
114 0.09
115 0.09
116 0.09
117 0.09
118 0.1
119 0.09
120 0.09
121 0.08
122 0.06
123 0.06
124 0.06
125 0.06
126 0.05
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.07
133 0.08
134 0.13
135 0.18
136 0.18
137 0.2
138 0.21
139 0.22
140 0.23
141 0.24
142 0.29
143 0.31
144 0.37
145 0.45
146 0.46
147 0.48
148 0.55
149 0.57
150 0.56
151 0.51
152 0.46
153 0.42
154 0.46
155 0.47
156 0.41
157 0.38
158 0.31
159 0.28
160 0.28
161 0.29
162 0.27
163 0.24
164 0.24
165 0.23
166 0.23
167 0.24
168 0.24
169 0.2
170 0.21
171 0.2
172 0.19
173 0.18
174 0.17
175 0.16
176 0.14
177 0.15
178 0.1
179 0.14
180 0.17
181 0.19
182 0.22
183 0.27