Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F849

Protein Details
Accession A7F849    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
124-146GGENSKQKEKPVKVNKWHEKFAQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019128  Dcc1  
Gene Ontology GO:0031390  C:Ctf18 RFC-like complex  
GO:0006260  P:DNA replication  
GO:0007064  P:mitotic sister chromatid cohesion  
KEGG ssl:SS1G_13779  -  
Pfam View protein in Pfam  
PF09724  Dcc1  
Amino Acid Sequences MSTQYANSIPFTANHTQQAFKLLELPPELLTLLESDTPPTVSNTASNHILKTYTLRQKNTSNPLMLLSPSSVQKIPEEEQEQEQAPSSFTSITQPSITRISSVDQTIELIEQEEEQDLEGQGQGGENSKQKEKPVKVNKWHEKFAQSRGRTSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.31
4 0.3
5 0.35
6 0.3
7 0.25
8 0.27
9 0.22
10 0.24
11 0.24
12 0.25
13 0.19
14 0.19
15 0.19
16 0.13
17 0.12
18 0.09
19 0.09
20 0.09
21 0.08
22 0.09
23 0.09
24 0.1
25 0.1
26 0.11
27 0.11
28 0.1
29 0.13
30 0.14
31 0.16
32 0.21
33 0.21
34 0.19
35 0.19
36 0.19
37 0.16
38 0.19
39 0.25
40 0.29
41 0.34
42 0.36
43 0.4
44 0.45
45 0.52
46 0.55
47 0.49
48 0.41
49 0.36
50 0.35
51 0.31
52 0.26
53 0.19
54 0.12
55 0.1
56 0.1
57 0.11
58 0.1
59 0.1
60 0.1
61 0.13
62 0.13
63 0.16
64 0.18
65 0.18
66 0.18
67 0.2
68 0.2
69 0.17
70 0.16
71 0.12
72 0.11
73 0.09
74 0.09
75 0.07
76 0.07
77 0.09
78 0.09
79 0.11
80 0.11
81 0.12
82 0.14
83 0.16
84 0.16
85 0.14
86 0.14
87 0.14
88 0.15
89 0.15
90 0.13
91 0.11
92 0.11
93 0.11
94 0.1
95 0.08
96 0.07
97 0.07
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.06
105 0.07
106 0.07
107 0.06
108 0.06
109 0.06
110 0.06
111 0.08
112 0.11
113 0.15
114 0.19
115 0.23
116 0.26
117 0.33
118 0.42
119 0.46
120 0.54
121 0.61
122 0.68
123 0.73
124 0.82
125 0.87
126 0.84
127 0.83
128 0.77
129 0.75
130 0.7
131 0.69
132 0.69
133 0.61