Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EXU7

Protein Details
Accession A7EXU7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
143-169GHAHGKGKGKGKERKRSPNAYERQPNYBasic
NLS Segment(s)
PositionSequence
146-179HGKGKGKGKERKRSPNAYERQPNYKGKDKGKGGG
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0008157  F:protein phosphatase 1 binding  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
KEGG ssl:SS1G_10162  -  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MASSTSNSAAARMQTHLQTEPQNRSQNQLQGSVTITQSQTHTSAPVLRLRGESTGESESSTNGERGLGRGRRIQWAEDVVDNEGLGRKKSKVCCIYHAPRPIDESSDESSSDSDDSSSDDDGGAKPSGGNGDKHDHGDECAHGHAHGKGKGKGKERKRSPNAYERQPNYKGKDKGKGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.25
4 0.27
5 0.33
6 0.38
7 0.43
8 0.47
9 0.53
10 0.51
11 0.55
12 0.56
13 0.54
14 0.49
15 0.47
16 0.39
17 0.32
18 0.33
19 0.3
20 0.25
21 0.22
22 0.2
23 0.16
24 0.17
25 0.18
26 0.17
27 0.15
28 0.15
29 0.13
30 0.17
31 0.18
32 0.21
33 0.21
34 0.21
35 0.22
36 0.22
37 0.22
38 0.2
39 0.19
40 0.17
41 0.18
42 0.16
43 0.16
44 0.15
45 0.13
46 0.13
47 0.13
48 0.1
49 0.09
50 0.09
51 0.09
52 0.1
53 0.18
54 0.19
55 0.2
56 0.25
57 0.26
58 0.32
59 0.33
60 0.32
61 0.27
62 0.26
63 0.25
64 0.22
65 0.21
66 0.15
67 0.14
68 0.12
69 0.1
70 0.11
71 0.1
72 0.09
73 0.1
74 0.11
75 0.16
76 0.19
77 0.27
78 0.32
79 0.33
80 0.38
81 0.45
82 0.49
83 0.51
84 0.56
85 0.49
86 0.42
87 0.44
88 0.39
89 0.32
90 0.28
91 0.24
92 0.19
93 0.19
94 0.19
95 0.15
96 0.15
97 0.14
98 0.13
99 0.09
100 0.06
101 0.06
102 0.07
103 0.08
104 0.08
105 0.07
106 0.07
107 0.08
108 0.08
109 0.11
110 0.1
111 0.08
112 0.08
113 0.08
114 0.12
115 0.13
116 0.14
117 0.15
118 0.2
119 0.22
120 0.24
121 0.25
122 0.22
123 0.21
124 0.22
125 0.19
126 0.16
127 0.15
128 0.14
129 0.13
130 0.14
131 0.17
132 0.21
133 0.26
134 0.3
135 0.35
136 0.43
137 0.49
138 0.57
139 0.62
140 0.66
141 0.72
142 0.77
143 0.82
144 0.83
145 0.86
146 0.85
147 0.86
148 0.84
149 0.84
150 0.84
151 0.78
152 0.78
153 0.75
154 0.75
155 0.71
156 0.73
157 0.71
158 0.69
159 0.73