Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7ENJ2

Protein Details
Accession A7ENJ2   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-28ITNSNRKRRIGTKPQRSSLKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.333, mito_nucl 12.666, cyto 3
Family & Domain DBs
KEGG ssl:SS1G_06891  -  
Amino Acid Sequences MVVKRGDITNSNRKRRIGTKPQRSSLKNSPHGVGLLNFIMYTGFDHDYDLPSEHLQSSWTPSGNLPRTPLCQGSSPEVLESEKIRFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.65
3 0.68
4 0.69
5 0.7
6 0.72
7 0.75
8 0.82
9 0.84
10 0.79
11 0.76
12 0.74
13 0.74
14 0.7
15 0.63
16 0.56
17 0.48
18 0.45
19 0.38
20 0.29
21 0.2
22 0.13
23 0.1
24 0.09
25 0.08
26 0.07
27 0.06
28 0.06
29 0.06
30 0.07
31 0.07
32 0.08
33 0.08
34 0.09
35 0.1
36 0.11
37 0.1
38 0.09
39 0.1
40 0.09
41 0.09
42 0.09
43 0.09
44 0.13
45 0.14
46 0.15
47 0.15
48 0.16
49 0.25
50 0.28
51 0.29
52 0.28
53 0.29
54 0.32
55 0.34
56 0.36
57 0.29
58 0.29
59 0.31
60 0.33
61 0.33
62 0.3
63 0.28
64 0.26
65 0.25
66 0.23
67 0.22