Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L1J7W0

Protein Details
Accession A0A0L1J7W0    Localization Confidence High Confidence Score 21.1
NoLS Segment(s)
PositionSequenceProtein Nature
184-203CGSCRKSKIRCTHRKPVVNPHydrophilic
252-275ATRVGRIPPKPRGRPRKQPEEIQAHydrophilic
283-307VEEPESPPRRPRRGRRPAQRMGTSAHydrophilic
NLS Segment(s)
PositionSequence
240-268KRAGLRPKSQPGATRVGRIPPKPRGRPRK
289-302PPRRPRRGRRPAQR
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MARPCKNCGAPRAEDAPDKIELCEQCTARDAPVASFDSQAGSPTEPNTPIPATQSDGSQGDDIHSGQGREAVDLDEPVLVPDPGSVLVGCRPSQIGTGTSAVAPMPAAPSGSALNGGNRLKRKASVLGLEEPILDTEPYQSVDSIGPVGTSNSGQSQGSSSSHEPSNSALAPNPAKKVKMEPACGSCRKSKIRCTHRKPVVNPRDDAFQQETKRPLQPKESGETSQDDTAHDDPGEESSKRAGLRPKSQPGATRVGRIPPKPRGRPRKQPEEIQAVVDEGNAVEEPESPPRRPRRGRRPAQRMGTSAEGKRGQATAPEPAAAAVPAETMAANLSIASNMALNNILAEDFQDTVRDCGEKWQTVSDSLRDAMDSFREAKHKIDTWLEMWRRGEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.44
4 0.4
5 0.36
6 0.31
7 0.31
8 0.28
9 0.27
10 0.31
11 0.28
12 0.26
13 0.29
14 0.3
15 0.25
16 0.28
17 0.26
18 0.2
19 0.25
20 0.27
21 0.23
22 0.23
23 0.22
24 0.2
25 0.19
26 0.2
27 0.16
28 0.15
29 0.15
30 0.16
31 0.2
32 0.19
33 0.2
34 0.22
35 0.22
36 0.21
37 0.23
38 0.23
39 0.23
40 0.22
41 0.22
42 0.22
43 0.21
44 0.22
45 0.19
46 0.18
47 0.15
48 0.16
49 0.15
50 0.15
51 0.16
52 0.14
53 0.13
54 0.17
55 0.16
56 0.15
57 0.15
58 0.13
59 0.12
60 0.12
61 0.12
62 0.09
63 0.09
64 0.08
65 0.09
66 0.08
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.06
73 0.06
74 0.1
75 0.12
76 0.13
77 0.13
78 0.13
79 0.13
80 0.15
81 0.16
82 0.14
83 0.14
84 0.15
85 0.15
86 0.14
87 0.14
88 0.12
89 0.1
90 0.09
91 0.06
92 0.06
93 0.06
94 0.06
95 0.05
96 0.07
97 0.07
98 0.08
99 0.09
100 0.08
101 0.09
102 0.15
103 0.17
104 0.21
105 0.24
106 0.26
107 0.26
108 0.28
109 0.3
110 0.3
111 0.31
112 0.31
113 0.32
114 0.33
115 0.32
116 0.3
117 0.27
118 0.22
119 0.19
120 0.14
121 0.1
122 0.06
123 0.07
124 0.07
125 0.09
126 0.09
127 0.09
128 0.09
129 0.1
130 0.1
131 0.09
132 0.08
133 0.07
134 0.06
135 0.07
136 0.06
137 0.06
138 0.07
139 0.07
140 0.08
141 0.08
142 0.08
143 0.09
144 0.1
145 0.11
146 0.14
147 0.14
148 0.16
149 0.17
150 0.17
151 0.16
152 0.15
153 0.17
154 0.14
155 0.14
156 0.12
157 0.14
158 0.17
159 0.19
160 0.22
161 0.2
162 0.2
163 0.21
164 0.24
165 0.29
166 0.32
167 0.33
168 0.33
169 0.37
170 0.43
171 0.45
172 0.43
173 0.39
174 0.4
175 0.44
176 0.45
177 0.49
178 0.52
179 0.61
180 0.69
181 0.73
182 0.77
183 0.78
184 0.8
185 0.77
186 0.78
187 0.77
188 0.7
189 0.63
190 0.53
191 0.49
192 0.42
193 0.39
194 0.32
195 0.28
196 0.26
197 0.29
198 0.31
199 0.29
200 0.34
201 0.35
202 0.33
203 0.34
204 0.39
205 0.38
206 0.4
207 0.4
208 0.36
209 0.34
210 0.34
211 0.3
212 0.25
213 0.22
214 0.18
215 0.18
216 0.17
217 0.16
218 0.14
219 0.12
220 0.1
221 0.12
222 0.15
223 0.11
224 0.11
225 0.11
226 0.14
227 0.14
228 0.18
229 0.23
230 0.26
231 0.35
232 0.43
233 0.49
234 0.5
235 0.52
236 0.53
237 0.51
238 0.53
239 0.45
240 0.42
241 0.37
242 0.4
243 0.44
244 0.43
245 0.46
246 0.47
247 0.55
248 0.6
249 0.69
250 0.73
251 0.77
252 0.84
253 0.85
254 0.87
255 0.82
256 0.81
257 0.77
258 0.75
259 0.66
260 0.57
261 0.48
262 0.37
263 0.31
264 0.23
265 0.16
266 0.07
267 0.07
268 0.05
269 0.05
270 0.04
271 0.06
272 0.07
273 0.16
274 0.2
275 0.21
276 0.29
277 0.39
278 0.49
279 0.58
280 0.67
281 0.7
282 0.78
283 0.87
284 0.9
285 0.91
286 0.9
287 0.9
288 0.84
289 0.75
290 0.68
291 0.64
292 0.58
293 0.49
294 0.47
295 0.39
296 0.35
297 0.34
298 0.3
299 0.23
300 0.23
301 0.23
302 0.22
303 0.21
304 0.21
305 0.19
306 0.19
307 0.19
308 0.14
309 0.12
310 0.06
311 0.05
312 0.05
313 0.05
314 0.05
315 0.05
316 0.05
317 0.05
318 0.05
319 0.05
320 0.05
321 0.05
322 0.05
323 0.05
324 0.06
325 0.05
326 0.06
327 0.07
328 0.07
329 0.07
330 0.07
331 0.07
332 0.06
333 0.07
334 0.07
335 0.07
336 0.08
337 0.1
338 0.11
339 0.12
340 0.14
341 0.14
342 0.12
343 0.2
344 0.27
345 0.29
346 0.29
347 0.35
348 0.35
349 0.4
350 0.43
351 0.37
352 0.33
353 0.3
354 0.29
355 0.24
356 0.23
357 0.2
358 0.19
359 0.19
360 0.18
361 0.21
362 0.26
363 0.27
364 0.29
365 0.35
366 0.36
367 0.38
368 0.42
369 0.42
370 0.39
371 0.48
372 0.49
373 0.47