Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L1JF08

Protein Details
Accession A0A0L1JF08    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
39-77QNVPLRPRTPRLRRRPNNKRNRNPKRRPLPRQNRMGSQSHydrophilic
NLS Segment(s)
PositionSequence
44-70RPRTPRLRRRPNNKRNRNPKRRPLPRQ
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
Amino Acid Sequences LALHVPCPRTIYRYRPTKNTSLTFSNPTPHQQHTNTTVQNVPLRPRTPRLRRRPNNKRNRNPKRRPLPRQNRMGSQSSRPCLRHITR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.62
3 0.66
4 0.68
5 0.7
6 0.65
7 0.61
8 0.56
9 0.55
10 0.51
11 0.46
12 0.43
13 0.37
14 0.38
15 0.36
16 0.33
17 0.36
18 0.32
19 0.34
20 0.36
21 0.4
22 0.36
23 0.34
24 0.32
25 0.28
26 0.3
27 0.27
28 0.25
29 0.24
30 0.24
31 0.25
32 0.3
33 0.38
34 0.45
35 0.54
36 0.61
37 0.68
38 0.76
39 0.85
40 0.9
41 0.91
42 0.92
43 0.93
44 0.93
45 0.93
46 0.95
47 0.95
48 0.94
49 0.94
50 0.94
51 0.94
52 0.94
53 0.94
54 0.94
55 0.92
56 0.92
57 0.87
58 0.84
59 0.78
60 0.75
61 0.68
62 0.66
63 0.66
64 0.62
65 0.63
66 0.56
67 0.54