Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L1ITT5

Protein Details
Accession A0A0L1ITT5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
273-302LIAIASRVFRRRRKRRQREPAPQAAPRRPGHydrophilic
NLS Segment(s)
PositionSequence
281-320FRRRRKRRQREPAPQAAPRRPGSSRSFKPWAKVKEVRRGP
Subcellular Location(s) extr 17, plas 4, mito 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQTTTITGSATITITIVPLTTIFTPPPDCSTSWTFAPTSSDSVVNGILLQNALSVVNSCYPPGFSNTGRAMATHVFSPGYCPMGYTSAEITVNGPTTTAICCPSNHNYYKTTITDSFPPPLLAGCLSSMPSAITTKVPVAAPGNGKETLVSGPLTMWAQPITVMLQSTDLSLYGDVSTSSTATPTPAVSATQPTLTYYDYNPTAPTALASNPPPTAATTTGTLMTPTISTAAIEPTNPTDLRGPDANETTALSSSAKAGIGIGAAALGLAVFLIAIASRVFRRRRKRRQREPAPQAAPRRPGSSRSFKPWAKVKEVRRGPPAELEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.06
5 0.06
6 0.08
7 0.09
8 0.11
9 0.11
10 0.14
11 0.17
12 0.19
13 0.23
14 0.24
15 0.23
16 0.27
17 0.32
18 0.32
19 0.31
20 0.32
21 0.28
22 0.26
23 0.3
24 0.27
25 0.25
26 0.23
27 0.22
28 0.19
29 0.2
30 0.19
31 0.15
32 0.13
33 0.1
34 0.08
35 0.08
36 0.07
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.1
44 0.11
45 0.11
46 0.11
47 0.12
48 0.14
49 0.17
50 0.2
51 0.18
52 0.25
53 0.26
54 0.29
55 0.28
56 0.26
57 0.25
58 0.22
59 0.22
60 0.16
61 0.15
62 0.12
63 0.12
64 0.15
65 0.14
66 0.14
67 0.13
68 0.13
69 0.13
70 0.15
71 0.16
72 0.14
73 0.14
74 0.14
75 0.14
76 0.14
77 0.13
78 0.12
79 0.13
80 0.11
81 0.1
82 0.08
83 0.08
84 0.09
85 0.09
86 0.1
87 0.11
88 0.12
89 0.16
90 0.22
91 0.28
92 0.31
93 0.33
94 0.32
95 0.34
96 0.38
97 0.35
98 0.34
99 0.29
100 0.27
101 0.3
102 0.3
103 0.29
104 0.25
105 0.24
106 0.19
107 0.17
108 0.16
109 0.1
110 0.09
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.06
117 0.07
118 0.07
119 0.08
120 0.08
121 0.08
122 0.08
123 0.1
124 0.1
125 0.1
126 0.11
127 0.13
128 0.15
129 0.15
130 0.18
131 0.16
132 0.16
133 0.15
134 0.14
135 0.12
136 0.11
137 0.09
138 0.06
139 0.06
140 0.07
141 0.07
142 0.06
143 0.06
144 0.05
145 0.05
146 0.05
147 0.06
148 0.05
149 0.05
150 0.05
151 0.05
152 0.06
153 0.06
154 0.06
155 0.06
156 0.05
157 0.05
158 0.05
159 0.05
160 0.04
161 0.04
162 0.04
163 0.04
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.06
171 0.06
172 0.06
173 0.06
174 0.07
175 0.07
176 0.09
177 0.1
178 0.1
179 0.1
180 0.1
181 0.11
182 0.11
183 0.12
184 0.11
185 0.14
186 0.14
187 0.14
188 0.14
189 0.13
190 0.12
191 0.11
192 0.11
193 0.08
194 0.08
195 0.11
196 0.12
197 0.13
198 0.13
199 0.13
200 0.13
201 0.13
202 0.14
203 0.13
204 0.13
205 0.12
206 0.13
207 0.14
208 0.13
209 0.12
210 0.1
211 0.09
212 0.08
213 0.06
214 0.06
215 0.06
216 0.06
217 0.06
218 0.09
219 0.09
220 0.09
221 0.1
222 0.11
223 0.14
224 0.14
225 0.15
226 0.16
227 0.17
228 0.2
229 0.22
230 0.22
231 0.22
232 0.24
233 0.23
234 0.2
235 0.2
236 0.17
237 0.15
238 0.14
239 0.11
240 0.09
241 0.1
242 0.1
243 0.1
244 0.08
245 0.08
246 0.07
247 0.07
248 0.06
249 0.05
250 0.03
251 0.03
252 0.03
253 0.03
254 0.02
255 0.02
256 0.02
257 0.02
258 0.01
259 0.01
260 0.02
261 0.02
262 0.03
263 0.03
264 0.05
265 0.09
266 0.16
267 0.25
268 0.34
269 0.46
270 0.57
271 0.68
272 0.78
273 0.87
274 0.91
275 0.94
276 0.97
277 0.97
278 0.95
279 0.95
280 0.91
281 0.87
282 0.85
283 0.81
284 0.77
285 0.69
286 0.65
287 0.57
288 0.56
289 0.57
290 0.58
291 0.58
292 0.59
293 0.65
294 0.62
295 0.68
296 0.7
297 0.69
298 0.68
299 0.7
300 0.7
301 0.71
302 0.78
303 0.77
304 0.76
305 0.73
306 0.67