Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EN76

Protein Details
Accession A7EN76    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
101-124KNTAAKKSKKEWRRIPLKIRKTISHydrophilic
NLS Segment(s)
PositionSequence
99-121RGKNTAAKKSKKEWRRIPLKIRK
Subcellular Location(s) plas 18, pero 3, nucl 1, mito 1, cyto 1, cyto_nucl 1, E.R. 1, golg 1, vacu 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR004776  Mem_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0055085  P:transmembrane transport  
KEGG ssl:SS1G_06775  -  
Pfam View protein in Pfam  
PF03547  Mem_trans  
Amino Acid Sequences MSDTDTASAALSRAKSYFLISSMVGNSLTFALGPKLLDDEEAPDELDEDSKADHTHSSNEHSESDEEYANPTNSNGRTAAEEEEFESETSTLLPRSIIRGKNTAAKKSKKEWRRIPLKIRKTISTIYSFINAPLLGALIGAILGLTPALHTAFFASPSSGGIFKAWLTTSVKNIGELFAALQLVVVGAKLSSSLIRMKNGQPSGKVPSLVVLTICIIRFILWPLVSIGVIYLIARKTQWLDEDPILWFVLMLMPTGPPATKLTALADVSGADEEEKMAIARFITVAYAVSPLICFAVVGSLKACLAAKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.18
4 0.2
5 0.18
6 0.19
7 0.17
8 0.2
9 0.19
10 0.19
11 0.17
12 0.14
13 0.13
14 0.11
15 0.11
16 0.08
17 0.08
18 0.08
19 0.09
20 0.09
21 0.09
22 0.1
23 0.11
24 0.11
25 0.11
26 0.13
27 0.14
28 0.15
29 0.15
30 0.12
31 0.13
32 0.12
33 0.13
34 0.09
35 0.07
36 0.07
37 0.08
38 0.09
39 0.09
40 0.12
41 0.12
42 0.17
43 0.19
44 0.24
45 0.27
46 0.29
47 0.28
48 0.28
49 0.28
50 0.25
51 0.24
52 0.2
53 0.16
54 0.17
55 0.19
56 0.17
57 0.16
58 0.15
59 0.18
60 0.18
61 0.2
62 0.18
63 0.16
64 0.17
65 0.19
66 0.21
67 0.17
68 0.16
69 0.15
70 0.16
71 0.16
72 0.14
73 0.13
74 0.1
75 0.09
76 0.09
77 0.09
78 0.07
79 0.07
80 0.08
81 0.07
82 0.13
83 0.2
84 0.24
85 0.26
86 0.3
87 0.31
88 0.38
89 0.42
90 0.46
91 0.47
92 0.51
93 0.53
94 0.59
95 0.66
96 0.67
97 0.73
98 0.73
99 0.75
100 0.77
101 0.8
102 0.82
103 0.83
104 0.84
105 0.82
106 0.76
107 0.68
108 0.62
109 0.56
110 0.49
111 0.42
112 0.35
113 0.27
114 0.26
115 0.24
116 0.19
117 0.17
118 0.13
119 0.09
120 0.07
121 0.06
122 0.04
123 0.04
124 0.04
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.01
133 0.02
134 0.02
135 0.03
136 0.03
137 0.03
138 0.05
139 0.05
140 0.06
141 0.07
142 0.06
143 0.06
144 0.07
145 0.08
146 0.06
147 0.07
148 0.06
149 0.06
150 0.06
151 0.07
152 0.07
153 0.08
154 0.11
155 0.12
156 0.14
157 0.18
158 0.18
159 0.18
160 0.18
161 0.16
162 0.13
163 0.11
164 0.1
165 0.06
166 0.06
167 0.05
168 0.04
169 0.04
170 0.04
171 0.03
172 0.03
173 0.02
174 0.02
175 0.02
176 0.02
177 0.03
178 0.03
179 0.05
180 0.11
181 0.13
182 0.15
183 0.18
184 0.21
185 0.28
186 0.32
187 0.33
188 0.29
189 0.31
190 0.35
191 0.34
192 0.32
193 0.24
194 0.22
195 0.21
196 0.19
197 0.16
198 0.1
199 0.09
200 0.1
201 0.1
202 0.08
203 0.07
204 0.08
205 0.08
206 0.1
207 0.12
208 0.11
209 0.11
210 0.12
211 0.13
212 0.12
213 0.11
214 0.09
215 0.06
216 0.06
217 0.05
218 0.07
219 0.07
220 0.08
221 0.08
222 0.09
223 0.11
224 0.13
225 0.17
226 0.17
227 0.21
228 0.22
229 0.24
230 0.24
231 0.23
232 0.21
233 0.17
234 0.13
235 0.09
236 0.1
237 0.08
238 0.08
239 0.07
240 0.07
241 0.08
242 0.09
243 0.08
244 0.08
245 0.1
246 0.12
247 0.13
248 0.14
249 0.16
250 0.2
251 0.2
252 0.19
253 0.17
254 0.14
255 0.14
256 0.13
257 0.11
258 0.07
259 0.06
260 0.06
261 0.06
262 0.06
263 0.06
264 0.06
265 0.07
266 0.06
267 0.07
268 0.07
269 0.07
270 0.07
271 0.07
272 0.07
273 0.07
274 0.08
275 0.08
276 0.08
277 0.07
278 0.07
279 0.08
280 0.07
281 0.06
282 0.05
283 0.12
284 0.12
285 0.13
286 0.13
287 0.14
288 0.14
289 0.16