Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L1J412

Protein Details
Accession A0A0L1J412   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
166-185SPRQPSWPSRGKREHTRLGYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, cyto 4.5, mito 4, cysk 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014729  Rossmann-like_a/b/a_fold  
IPR032678  tRNA-synt_1_cat_dom  
Pfam View protein in Pfam  
PF01406  tRNA-synt_1e  
Amino Acid Sequences MSVPLPGTTITRVAVIFDQASSDTPNSPRNAVVADEAFYKAIQDVSLPYLDEIKGSTIPGNEHVVFAELTQKYEERFMRSMRDLGLDEVTQVTEYDPSIVEYVEEIVANEFAYAPSDGSVFQSQSFAGSHGTETINLCIEMGNQLYLIRLRKGHLMTLSLEGVTPSPRQPSWPSRGKREHTRLGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.12
5 0.13
6 0.12
7 0.13
8 0.14
9 0.14
10 0.15
11 0.17
12 0.23
13 0.24
14 0.25
15 0.24
16 0.22
17 0.23
18 0.21
19 0.21
20 0.16
21 0.15
22 0.15
23 0.16
24 0.15
25 0.13
26 0.12
27 0.09
28 0.09
29 0.08
30 0.07
31 0.07
32 0.09
33 0.1
34 0.1
35 0.09
36 0.11
37 0.11
38 0.1
39 0.09
40 0.09
41 0.09
42 0.1
43 0.11
44 0.1
45 0.11
46 0.13
47 0.17
48 0.15
49 0.15
50 0.14
51 0.14
52 0.13
53 0.12
54 0.17
55 0.12
56 0.13
57 0.14
58 0.14
59 0.14
60 0.19
61 0.2
62 0.18
63 0.21
64 0.21
65 0.25
66 0.26
67 0.26
68 0.22
69 0.22
70 0.18
71 0.17
72 0.17
73 0.12
74 0.11
75 0.09
76 0.09
77 0.07
78 0.06
79 0.05
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.05
87 0.05
88 0.05
89 0.06
90 0.05
91 0.05
92 0.04
93 0.04
94 0.05
95 0.05
96 0.05
97 0.04
98 0.04
99 0.05
100 0.05
101 0.05
102 0.05
103 0.06
104 0.06
105 0.09
106 0.1
107 0.09
108 0.09
109 0.1
110 0.09
111 0.1
112 0.1
113 0.09
114 0.09
115 0.08
116 0.08
117 0.1
118 0.11
119 0.11
120 0.12
121 0.12
122 0.11
123 0.11
124 0.11
125 0.08
126 0.08
127 0.09
128 0.08
129 0.08
130 0.07
131 0.07
132 0.08
133 0.12
134 0.14
135 0.15
136 0.15
137 0.17
138 0.23
139 0.25
140 0.28
141 0.27
142 0.26
143 0.26
144 0.28
145 0.27
146 0.21
147 0.19
148 0.15
149 0.14
150 0.14
151 0.14
152 0.13
153 0.17
154 0.17
155 0.22
156 0.29
157 0.38
158 0.44
159 0.52
160 0.57
161 0.62
162 0.72
163 0.76
164 0.79
165 0.8