Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L1IMS7

Protein Details
Accession A0A0L1IMS7    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
227-252HAALSYRMKKKSRHVRKSVRMQPGLQHydrophilic
NLS Segment(s)
PositionSequence
235-242KKKSRHVR
Subcellular Location(s) nucl 13, cyto_nucl 9.5, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MHRQLRLDTSVGDSQRYSFIETPLEMHASGLRNGQQQQEPLPSQSIAGSKSDPLPAQAAAEQGQPKRLPPLNEKAQYVRQEMMSPGHPGGPNSEEHPAISAPFADVVPQPVQQHDAVVPDYSYAVPPPNSPGPLPAKTYPETPAQVTRLQTMAIVPDTNPLQSPQVPYFPGPPKASGTSYTPLADEVAAYHRPGQGSWRQSNIDESAKRMVSEETLHQIVLERPVVHAALSYRMKKKSRHVRKSVRMQPGLQEQSLYRRIWLPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.27
4 0.27
5 0.23
6 0.24
7 0.25
8 0.25
9 0.26
10 0.24
11 0.25
12 0.19
13 0.17
14 0.19
15 0.18
16 0.19
17 0.2
18 0.21
19 0.24
20 0.26
21 0.31
22 0.31
23 0.3
24 0.33
25 0.37
26 0.36
27 0.33
28 0.33
29 0.28
30 0.25
31 0.25
32 0.24
33 0.18
34 0.18
35 0.17
36 0.16
37 0.18
38 0.21
39 0.18
40 0.18
41 0.18
42 0.16
43 0.17
44 0.16
45 0.15
46 0.13
47 0.17
48 0.2
49 0.19
50 0.24
51 0.23
52 0.23
53 0.29
54 0.32
55 0.33
56 0.35
57 0.44
58 0.48
59 0.52
60 0.53
61 0.5
62 0.53
63 0.52
64 0.48
65 0.4
66 0.31
67 0.29
68 0.28
69 0.26
70 0.21
71 0.19
72 0.16
73 0.18
74 0.18
75 0.16
76 0.18
77 0.17
78 0.16
79 0.16
80 0.18
81 0.14
82 0.14
83 0.15
84 0.12
85 0.11
86 0.1
87 0.08
88 0.06
89 0.07
90 0.06
91 0.06
92 0.06
93 0.09
94 0.1
95 0.12
96 0.12
97 0.12
98 0.14
99 0.13
100 0.13
101 0.11
102 0.12
103 0.1
104 0.1
105 0.09
106 0.07
107 0.08
108 0.07
109 0.07
110 0.06
111 0.07
112 0.07
113 0.07
114 0.11
115 0.12
116 0.13
117 0.13
118 0.17
119 0.2
120 0.21
121 0.25
122 0.23
123 0.25
124 0.25
125 0.27
126 0.25
127 0.24
128 0.23
129 0.21
130 0.22
131 0.2
132 0.22
133 0.22
134 0.2
135 0.17
136 0.16
137 0.14
138 0.12
139 0.1
140 0.08
141 0.08
142 0.07
143 0.09
144 0.09
145 0.09
146 0.09
147 0.09
148 0.1
149 0.12
150 0.15
151 0.14
152 0.17
153 0.17
154 0.18
155 0.24
156 0.26
157 0.31
158 0.29
159 0.29
160 0.3
161 0.31
162 0.32
163 0.27
164 0.27
165 0.23
166 0.24
167 0.22
168 0.19
169 0.17
170 0.16
171 0.13
172 0.09
173 0.08
174 0.1
175 0.1
176 0.11
177 0.12
178 0.14
179 0.14
180 0.14
181 0.18
182 0.22
183 0.29
184 0.31
185 0.34
186 0.34
187 0.34
188 0.38
189 0.37
190 0.38
191 0.31
192 0.31
193 0.32
194 0.31
195 0.3
196 0.28
197 0.24
198 0.19
199 0.2
200 0.2
201 0.2
202 0.2
203 0.19
204 0.18
205 0.19
206 0.19
207 0.2
208 0.2
209 0.15
210 0.15
211 0.17
212 0.17
213 0.15
214 0.15
215 0.13
216 0.18
217 0.24
218 0.3
219 0.35
220 0.43
221 0.49
222 0.53
223 0.63
224 0.66
225 0.72
226 0.76
227 0.81
228 0.84
229 0.89
230 0.94
231 0.93
232 0.92
233 0.86
234 0.77
235 0.73
236 0.72
237 0.67
238 0.56
239 0.48
240 0.39
241 0.42
242 0.46
243 0.39
244 0.31
245 0.32